DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and cyp-31A3

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_500637.2 Gene:cyp-31A3 WormBaseID:WBGene00021200 Length:495 Species:Caenorhabditis elegans

Alignment Length:414 Identity:113/415 (27%)
Similarity:199/415 (48%) Gaps:42/415 (10%)


  Fly   102 NRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAK-TT 165
            |:|..|..::..|..::.:.:.::||..|..|||||....:|:..||.    .|..||...| .:
 Worm   101 NKGFAYVLLEPWLGISILTSQKEQWRPKRKLLTPTFHYDILKDFLPIF----NEQSKILVQKMCS 161

  Fly   166 TGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFV----TIGKRAIIERRYGGLL--DF 224
            .|..:.::::.::...|.|:|...:.|....:....|.|:|    ||.|  :|.:|....|  :.
 Worm   162 LGAEEEVDVLSVITLCTLDIICETSMGKAIGAQLAENNEYVWAVHTINK--LISKRTNNPLMWNS 224

  Fly   225 LIFGFPKLSRRLRLKLNVQDVEDFYTSIV---RNTI---DYRLRTNEKRHDFMDSLIEMYEKEQA 283
            .|:...:..|.....|.:  :.||...::   :..:   ||::   |.|..|:|.|:||.:..|.
 Worm   225 FIYNLTEDGRTHEKCLRI--LHDFTKKVIVERKEALQENDYKM---EGRLAFLDLLLEMVKSGQM 284

  Fly   284 GNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTY 348
            ..|       ::.|:...|...|.:|:||.:.:|::.|....::|.:::||::.|:. .:.:.|.
 Worm   285 DET-------DVQAEVDTFMFEGHDTTSTGLMWAIHLLGNHPEVQRKVQAELDEVMG-DDEDVTI 341

  Fly   349 EGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPE 413
            |.:..|||||..:.|.||.:|.:..:||....|.......  |.||.|.::....:|.||..:.:
 Worm   342 EHLSRMKYLECALKEALRLFPSVPIITRELSDDQVIGGVN--IPKGVTFLLNLYLVHRDPSQWKD 404

  Fly   414 PEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYK---FSVSTETQ 475
            |:.|.|:||..|...||.|..::||..|.|||||.||.||:..|.:|:|:|.:.   ..:..|.:
 Worm   405 PDVFDPDRFLPENSIARKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNVKAVELMHEVR 469

  Fly   476 IPMKFVVKSILLSAENGIHLKVEK 499
            ..|:.:|:.:     ..||:|:.:
 Worm   470 PKMEIIVRPV-----TPIHMKLTR 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 112/409 (27%)
cyp-31A3NP_500637.2 p450 36..472 CDD:278495 108/392 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.