DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and cyp-13A7

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_496114.1 Gene:cyp-13A7 WormBaseID:WBGene00000372 Length:518 Species:Caenorhabditis elegans

Alignment Length:542 Identity:145/543 (27%)
Similarity:266/543 (49%) Gaps:82/543 (15%)


  Fly     9 ALLVSLLLFMARRRH-----GYWQRRGIPHDVPHPIYGNMKDWPKKRHI-AMIFRDYYTKYKRSV 67
            ::|:::.:|:....:     .:|.|:|:......|..|.:..:....:. |:.|.::..||.   
 Worm     4 SILIAIAIFVGIISYYLWIWSFWIRKGVKGPRGLPFLGVIHKFTNYENPGALKFSEWTKKYG--- 65

  Fly    68 YPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDP---LSATLFSIEGQKWRHL 129
             |..|......::.||:|.|.|..|.:|.|::|..|.:...: .||   ....|.:.:|.:|:.|
 Worm    66 -PVYGITEGVEKTLVISDPEFVHEVFVKQFDNFYGRKLTAIQ-GDPNKNKRVPLVAAQGHRWKRL 128

  Fly   130 RHKLTPTFTSGKMKNMFPIIVKVGEEM-EKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGL 193
            |...:|||::   |::..|:..|.|.: |.:.|.:..:.||:.|::::....:|.|:||..|.|.
 Worm   129 RTLASPTFSN---KSLRKIMGTVEESVTELVRSLEKASAEGKTLDMLEYYQEFTMDIIGKMAMGQ 190

  Fly   194 NCNSL-QNPNAEFV-TIGKRAIIERRYGGLLDFLIFGFPKLSRR--------LRLKLNVQDVEDF 248
            ..:.: :||..:.| ||.|    |.|....:...||.|..::.|        |::..::|     
 Worm   191 EKSLMFRNPMLDKVKTIFK----EGRNNVFMISGIFPFVGIALRNIFAKFPSLQMATDIQ----- 246

  Fly   249 YTSIVRNTIDYRLRTNE-----------KRHDFMD------SLIEMYE--------KEQAGNTED 288
              ||:...::.||...|           :..||:|      |.::.:|        |.:....:.
 Worm   247 --SILEKALNKRLEQREADEKAGIEPSGEPQDFIDLFLDARSTVDFFEGEAEQDFAKSEVLKVDK 309

  Fly   289 GLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKE 353
            .|:|:||:.|.|:|.:||::|::.::.::.|.||...:||.:|:.|::....  :.|.|::.:.:
 Worm   310 HLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLATHPEIQKKLQEEVDRECP--DPEVTFDQLSK 372

  Fly   354 MKYLEQVVMETLRKYPV--LAHLTRMTQTD--FSPEDPKYFIAKGTTVVIPALGIHYDPEIY-PE 413
            :||||.||.|.||.||:  |.|..:..:|.  ...|     |..||.:.:....:|:||::: .:
 Worm   373 LKYLECVVKEALRLYPLASLVHNRKCLKTTNVLGME-----IEAGTNINVDTWSLHHDPKVWGDD 432

  Fly   414 PEKFKPERFT--DEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQI 476
            ..:|||||:.  ||...|:..  :||||.|||.|||:|..:|:..:.|..:::.|.|..:.||.|
 Worm   433 VNEFKPERWESGDELFFAKGG--YLPFGMGPRICIGMRLAMMEMKMLLTNILKNYTFETTPETVI 495

  Fly   477 PMKFVVKSILLSAENGIHLKVE 498
            |:|.|..:.:  |.:.:.||::
 Worm   496 PLKLVGTATI--APSSVLLKLK 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 138/506 (27%)
cyp-13A7NP_496114.1 p450 33..499 CDD:278495 136/494 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I2561
Isobase 1 0.950 0 Normalized mean entropy S3433
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97993
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.711 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2429
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.