DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and cyp-13A3

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_496110.1 Gene:cyp-13A3 WormBaseID:WBGene00011675 Length:520 Species:Caenorhabditis elegans

Alignment Length:548 Identity:149/549 (27%)
Similarity:262/549 (48%) Gaps:92/549 (17%)


  Fly     8 IALLVSLLLFMARRRH-----GYWQRRGIPHDVPHPIYGNM-------KDWPKKRHIAMIFR--D 58
            :::|:::.||:....:     .:|.|:||......|.:|.:       |.|        |.|  |
 Worm     3 LSILIAIALFIGVFTYYLWIWSFWMRKGIKGPRGLPFFGIINAFQSYEKPW--------ILRLGD 59

  Fly    59 YYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSAT------ 117
            :..:|.    |..||.....::.|::|.|.|..|.:|.|::      ||....:||...      
 Worm    60 WTKEYG----PMYGFTDGVEKTLVVSDPEFVHEVFVKQFDN------FYARKQNPLQGDPDKDPR 114

  Fly   118 --LFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVK-VGEEMEKIFSAKTTTGEGQVLEIVDLVA 179
              |.:.:|.:|:.||...:|||::..::.:|..:.: |.|.|..:  .|.|.| |:.::|::...
 Worm   115 IHLVTSQGHRWKRLRTLASPTFSNKSLRKIFSTVEESVAEMMRHL--EKGTAG-GKTIDILEYYQ 176

  Fly   180 RYTADVIGNCAFGLNCNSL-QNPNAEFVTIGKRAIIERRYGGLLDFLIFGF-PKLSRRLRLKLNV 242
            .:|.|:||..|.|.:.:.: :||..:.:    |||...|  |.:.|:|.|. |......|...:.
 Worm   177 EFTMDIIGKIAMGQSGSMMFENPWLDKI----RAIFNTR--GNIIFIICGIVPFTGSIFRWFFSK 235

  Fly   243 QDVEDFYTSIVRNTIDYRL-------RTNEKR--------HDFMDSLIEM--------------Y 278
            .......||:: :|::..|       ..:||.        .||:|..:::              :
 Worm   236 VPTAQTVTSLM-HTLEIALTKRVEQRAADEKAGIESSGEPQDFIDLFLDVQADTDFLEDETKNGF 299

  Fly   279 EKEQAGNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHN 343
            .:.|....:..|:|:||:.|.|:|.:||::|::.::.::.|.||...:||.:|:.|::....  :
 Worm   300 ARSQIVKVDKHLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLARHPEIQKKLQEEVDRECP--D 362

  Fly   344 NEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDP 408
            .|.|::.:.::||:|.|:.||||.|| ||.:....:...|.......|.:||.|......:||||
 Worm   363 PEVTFDQLSKLKYMECVIKETLRLYP-LASIVHNRKCMKSTTVLGMKIEEGTNVQADTWTLHYDP 426

  Fly   409 EIYPE-PEKFKPERFT--DEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSV 470
            :.:.| ..:|||||:.  ||...|:.:  :||||.|||.|||:|...|:..:.||.:::.|....
 Worm   427 KFWGENANEFKPERWESGDEQAVAKGA--YLPFGLGPRICIGMRLAYMEEKMLLAQILKKYSLET 489

  Fly   471 STETQIPMKFVVKSILLSAENGIHLKVE 498
            :.||.||:|.|  .|..:|...:|||::
 Worm   490 TFETHIPLKLV--GIATTAPTNVHLKLK 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 140/511 (27%)
cyp-13A3NP_496110.1 p450 33..512 CDD:278495 140/514 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I2561
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97993
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.702 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.