DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and cyp-13A6

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_496113.1 Gene:cyp-13A6 WormBaseID:WBGene00011673 Length:518 Species:Caenorhabditis elegans

Alignment Length:542 Identity:144/543 (27%)
Similarity:251/543 (46%) Gaps:118/543 (22%)


  Fly    25 YWQRRGI--PHDVP------------HPIYGNMKDWPKKRHIAMIFRDYYTKYKRSVY-PFAGFY 74
            |:.|:||  |...|            :|.:...:||.|:                  | |..||.
 Worm    23 YFIRKGIKGPRGFPGIGMLIQTIDHENPPFLKYRDWTKQ------------------YGPVYGFT 69

  Fly    75 FFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDP---LSATLFSIEGQKWRHLRHKLTPT 136
            ....::.:|::.|:|..:..|.|::|..|.: ...|.||   ....:||.:|::|:.||...:|:
 Worm    70 EGPQQTMIISEPEMVNEIFKKQFDNFYGRKL-RPIIGDPEKDKRVNIFSTQGKRWKRLRTLSSPS 133

  Fly   137 FTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLN-CNSLQN 200
            |::..::.:...:.:.|.|:  :::.:....:.:.::::.:...||..||...|.|.: .|..:|
 Worm   134 FSNNSLRKVRNSVQECGTEI--LWNIEQKVRKNEDIDMLIVYQEYTLGVISRIALGQSESNMFKN 196

  Fly   201 PNAEFVTIGKRAIIERRYGGLLDFLIFG--------FPKLSRRL--------------------- 236
            |....|    :||..   |....|||.|        |.|:|:.|                     
 Worm   197 PLLPKV----QAIFN---GSWHVFLITGIFPPLAGVFRKMSKMLPASFIPAFKIFDLIEVAVQAR 254

  Fly   237 ---RLKLNVQDVE-----DFYTSIVRNTI-DYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSF 292
               |.|..::.||     ||....:...: |.::.:.|...||..|.:....||        |:|
 Worm   255 IDQRAKDEIKGVEPGEPQDFIDLFLDARVPDVKILSGEANEDFAKSSVVKINKE--------LTF 311

  Fly   293 NEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYL 357
            :||:||.|:|..|||:|::.::.:|.|.||...:||.:|:.|::....  :.|..::.:.::|||
 Worm   312 DEIIAQCFVFLAAGFDTTALSLSYATYLLATHPEIQTKLQEEVDRECP--DPEIFFDHLSKLKYL 374

  Fly   358 EQVVMETLRKYPV--LAHLTR-MTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEP-EKFK 418
            |.|:.||||.||:  .|:..: |.:|..:..:    ..:|..:.:....:|::|.|:.|. |.||
 Worm   375 ECVMKETLRLYPLGTTANTRKCMRETTINGVN----FDEGMNIQVDTWTLHHNPRIWGEDVEDFK 435

  Fly   419 PERFTDEAIAARPSC-------TWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQI 476
            |||:.:.|      |       :::|||.|||.|||:|...|:..:.||.:::.|.|..:..|||
 Worm   436 PERWENGA------CEHLEHNGSYIPFGSGPRQCIGMRLAQMEQKILLAQILKEYSFRTTKNTQI 494

  Fly   477 PMKFVVKSILLSAENGIHLKVE 498
            |:|.|.| :.||.|:.| :|:|
 Worm   495 PVKLVGK-LTLSPESVI-VKLE 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 137/525 (26%)
cyp-13A6NP_496113.1 p450 31..508 CDD:278495 137/526 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I2561
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97993
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.716 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2429
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.