DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and cyp-32B1

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_503598.1 Gene:cyp-32B1 WormBaseID:WBGene00021167 Length:516 Species:Caenorhabditis elegans

Alignment Length:563 Identity:135/564 (24%)
Similarity:238/564 (42%) Gaps:118/564 (21%)


  Fly     3 LLLTLIALLV-----SLLLFMARRR---HGYWQRRGIPHDVPHPIYGNMKDWP-KKRHIAMIF-- 56
            ||||..|.|:     .:|.|:..|:   ..:.:.||.|..:   |:|.:  |. ||..:.|::  
 Worm     8 LLLTYFAYLIFRQKDDILQFLHVRKICTREFKKLRGPPAVL---IFGTL--WYFKKDPVEMVYQA 67

  Fly    57 RDYYTKY----------KRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEID 111
            :.::::|          |..:.|..        :..|...|:.|.||....|  .::...||::.
 Worm    68 QAWFSEYTLAPDNCGVLKLWLGPIP--------AVNIARGEIAKIVLDSSVN--ISKSSQYNKLK 122

  Fly   112 DPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVL---- 172
            :.:...|....|.|||..|..||.||....:|           |.:|||.|     :|::|    
 Worm   123 EWIGDGLLISTGDKWRSRRKMLTQTFHFAVLK-----------EYQKIFGA-----QGKILVEVL 171

  Fly   173 ----------EIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIF 227
                      :|:..:.|...|:|...|.|.:.:|.:..|.|:|...:|          |..:::
 Worm   172 QLRANNKFSFDIMPYIKRCALDIICETAMGCSISSQRGANDEYVNSVRR----------LSEIVW 226

  Fly   228 GFPK------------------LSRRLRLKLNVQDVEDFYTSIVRNTIDYRLRT-----NE-KRH 268
            .:.|                  .:|.::|      ..||...::.|. ...|:|     || |:.
 Worm   227 NYEKAPQFWLKPIWYLFGDGFEFNRHVKL------TTDFTRDVIENR-KKELKTHNSEQNETKKL 284

  Fly   269 DFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRA 333
            .|:|.|::..|:.....|::|     |..:...|...|.:|:|:.:.||::.|....:.|.::..
 Worm   285 AFLDYLLKSQEEHPDILTDEG-----IREEVDTFMFEGHDTTSSGITFAVWFLGQFPEYQQRVHD 344

  Fly   334 EINNVLSKHNNEF-TYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFS---PEDPKYFIAKG 394
            |::.:..:..... ..|.|::|.||||.:.||||..|.:..::|....|..   ...|...:..|
 Worm   345 ELDEIFGEDFERIPNSEDIQKMVYLEQCIKETLRMTPPVPFVSRKLTEDVKIPHATKPDLLLPAG 409

  Fly   395 TTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGL 459
            ...:|..:.|..|...:..|.:|.||.|:.|.:|||....::||..|||||||.:|.|::..|.|
 Worm   410 INCMINIITIMKDARYFERPYEFFPEHFSPERVAAREPFAFVPFSAGPRNCIGQKFALLEEKVLL 474

  Fly   460 AYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKLSK 502
            :::.|  .|:|::.|:.|.:..:..::|..:.|..:.:....|
 Worm   475 SWIFR--NFTVTSMTKFPEEMPIPELILKPQFGTQVLLRNRRK 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 122/514 (24%)
cyp-32B1NP_503598.1 p450 42..510 CDD:278495 125/523 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.