DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and Cyp3a59

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001098630.1 Gene:Cyp3a59 MGIID:3769707 Length:503 Species:Mus musculus

Alignment Length:520 Identity:165/521 (32%)
Similarity:264/521 (51%) Gaps:55/521 (11%)


  Fly     6 TLIALLVSLLLF--MARRRHGYWQRRGIPHDVPHPIYGNMKD-----WPKKRHIAMIFRDYYTKY 63
            |.:.|:.||:.|  .....||.:::.|||...|.|::|.:.:     |       ....|.|.||
Mouse    11 TWVLLVTSLVFFYIYGTYSHGLFKKLGIPGPKPLPLFGTIFNYFDGMW-------KFDEDCYKKY 68

  Fly    64 KRSVYPFAGFYFFFTRSAVITDLELVKRVLIKD-FNHFENRGIFYNEIDDPLSATLFSI---EGQ 124
            .:    ..|||........|.|.|::|.||:|: ::.|.||...     .|:.....||   |.:
Mouse    69 GK----IWGFYVGPKPILAIMDPEIIKIVLVKECYSVFTNRPTL-----GPVGFLKKSITISEDE 124

  Fly   125 KWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNC 189
            :|:.||..|:|||||||:|.||||:.:.|:.:  :.:.:....:|:.:.:.|:...|:.|||...
Mouse   125 EWKRLRTLLSPTFTSGKLKEMFPIMRQYGDIL--VRNLRREEEKGEPINMKDIFGAYSMDVITGT 187

  Fly   190 AFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFG--------FPKLS---RRLRLKLNVQ 243
            :||:|.:||.||...||...|:         :|.|.||.        ||.|:   ..|.|.:..:
Mouse   188 SFGVNIDSLNNPQNPFVQKTKK---------ILKFKIFDPFLLSTILFPFLTPIYEMLNLSIFPR 243

  Fly   244 DVEDFYTSIVRNTIDYRLRTNEK-RHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGF 307
            |..:|:...|:.....||.:.:| |.||:..::.. :..:...::..||..|:.|||.||...|:
Mouse   244 DSMNFFKKFVKRMKKERLASKQKNRVDFLQLMMNT-QNSKGQESQKALSDLEMAAQAVIFIFGGY 307

  Fly   308 ETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLA 372
            :.:||::...:||||...|:|.:|:.||:..| .:....||:.:.:|:||:.||.|:||.||...
Mouse   308 DATSTSISLIMYELATHPDVQKKLQDEIDRTL-PNKAPVTYDALMDMEYLDMVVNESLRLYPTAI 371

  Fly   373 HLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLP 437
            .|.|:::.|.  |....||.|||.|:||...:|.:||.:|||::|.|.||:.|.........::|
Mouse   372 RLERVSKKDV--EINGVFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPGRFSKENEGNIDPYIYMP 434

  Fly   438 FGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKLSK 502
            ||.|||||:.:||.|:...:.:..:::.:......|||||:| :.:..:...|..|.|||....|
Mouse   435 FGNGPRNCLDMRFALISMKLAVIGVLQNFTVQPCEETQIPLK-ISREPVFQPEKPIILKVVSRDK 498

  Fly   503  502
            Mouse   499  498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 151/480 (31%)
Cyp3a59NP_001098630.1 p450 39..493 CDD:278495 154/486 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.