DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ciao1 and CIA1

Sequence 1:NP_610996.1 Gene:Ciao1 FlyBaseID:FBgn0033972 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_010553.3 Gene:CIA1 SGDID:S000002675 Length:330 Species:Saccharomyces cerevisiae

Alignment Length:343 Identity:125/344 (36%)
Similarity:194/344 (56%) Gaps:27/344 (8%)


  Fly     1 MGRLILEHTLQGHKGRIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWSTKTILSD-GHKRTIRE 64
            |..:.|..:|:.:|.:||...:  ...:.|:...|:.|::.|:..:.::...:|.: .||:.||.
Yeast     1 MASINLIKSLKLYKEKIWSFDF--SQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRS 63

  Fly    65 IRWSPCGQYLASASFDATTAIWSKSSG-----EFECNATLEGHENEVKSVSWSRSGGLLATCSRD 124
            :.|.|....||:.|||:|.:||:|...     |.:..|.:||||||||.|:||..|..|||||||
Yeast    64 VAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRD 128

  Fly   125 KSVWIWEV-AGDDEFECAAVLNPHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCTA 188
            |||||||. ...:|:||.:||..|:||||.|:|||::.:|||:|||:|::::.:  .|:||:|.|
Yeast   129 KSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKD--YDDDWECVA 191

  Fly   189 TLTSHTSTVWGIDFD-ADGE-RLVSCSDDTTIKIWRAYHPGNTAGVATPDQQTVWKCVCTVSGQH 251
            .|..|..|||..||| .:|. ||.|.|||:|:::|:  :.|:     ..|.|..|.|...:...|
Yeast   192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWK--YMGD-----DEDDQQEWVCEAILPDVH 249

  Fly   252 SRAIYDVSWCKLTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEEGAHDQDVNSVQWNPVVA 316
            .|.:|:|:| ...||||:. |.||:....|..|.  :...|.:.....|.:  ::|.|:|..:..
Yeast   250 KRQVYNVAW-GFNGLIASV-GADGVLAVYEEVDG--EWKVFAKRALCHGVY--EINVVKWLELNG 308

  Fly   317 GQLISC-SDDGTIKIWKV 333
            ..:::. .|||.:..|.:
Yeast   309 KTILATGGDDGIVNFWSL 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ciao1NP_610996.1 WD40 6..332 CDD:238121 124/336 (37%)
WD40 9..>333 CDD:225201 123/334 (37%)
WD40 repeat 17..57 CDD:293791 7/41 (17%)
WD40 repeat 63..101 CDD:293791 15/43 (35%)
WD40 repeat 106..145 CDD:293791 25/40 (63%)
WD40 repeat 152..191 CDD:293791 18/39 (46%)
WD40 repeat 197..248 CDD:293791 19/53 (36%)
WD40 repeat 255..299 CDD:293791 13/44 (30%)
WD40 repeat 306..331 CDD:293791 6/26 (23%)
CIA1NP_010553.3 WD40 6..325 CDD:238121 124/336 (37%)
WD40 repeat 17..54 CDD:293791 7/39 (18%)
WD40 repeat 63..105 CDD:293791 14/42 (33%)
WD40 repeat 111..151 CDD:293791 24/40 (60%)
WD40 repeat 156..194 CDD:293791 19/40 (48%)
WD40 repeat 201..246 CDD:293791 18/52 (35%)
WD40 repeat 253..289 CDD:293791 13/40 (33%)
WD40 repeat 298..326 CDD:293791 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238121855
eggNOG 1 0.900 E1_KOG0645
Hieranoid 1 1.000
Homologene 1 1.000 H55850
Inparanoid 1 1.050 216 1.000 Inparanoid score I782
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005128
OrthoInspector 1 1.000 T1135893
orthoMCL 1 0.900 OOG5_127906
Panther 1 1.100 LDO PTHR19920
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2069
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.