DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ciao1 and emb1345

Sequence 1:NP_610996.1 Gene:Ciao1 FlyBaseID:FBgn0033972 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_565615.1 Gene:emb1345 AraportID:AT2G26060 Length:352 Species:Arabidopsis thaliana

Alignment Length:338 Identity:165/339 (49%)
Similarity:218/339 (64%) Gaps:19/339 (6%)


  Fly    10 LQGHKGRIWGVAWHPKGN-------VFASCGEDKAIRIW--SLTGNTWSTKTILSDGHKRTIREI 65
            |:||..|:|.|||:|..:       :.|||..|..:|||  |....:|:.||:|.:.|.||:|..
plant    16 LEGHTDRVWSVAWNPVSSHADGVSPILASCSGDNTVRIWEQSSLSRSWTCKTVLEETHTRTVRSC 80

  Fly    66 RWSPCGQYLASASFDATTAIWSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCSRDKSVWIW 130
            .|||.||.||:||||.||.||.....||||.:||||||||||||||:.||..|||||||||||||
plant    81 AWSPSGQLLATASFDGTTGIWKNYGSEFECISTLEGHENEVKSVSWNASGSCLATCSRDKSVWIW 145

  Fly   131 EVAGDDEFECAAVLNPHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCTATL----T 191
            ||...:|::|||||..||||||.|.||||.|:|.|.|||||||::..|..|.::.|..||    .
plant   146 EVLEGNEYDCAAVLTGHTQDVKMVQWHPTMDVLFSCSYDNTIKVWWSEDDDGEYQCVQTLGESNN 210

  Fly   192 SHTSTVWGIDFDADGERLVSCSDDTTIKIWRAYHPGNTAGVATPDQQTVWKCVCTVSGQHSRAIY 256
            .|:||||.|.|:|.|:::|:||||.|:|||..    :.|.:.:.::...|..:||:||.|.|.||
plant   211 GHSSTVWSISFNAAGDKMVTCSDDLTLKIWGT----DIAKMQSGEEYAPWIHLCTLSGYHDRTIY 271

  Fly   257 DVSWCKLTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEEGAHDQDVNSVQWNPVVAGQLI- 320
            ...|.: ..:||:..||:.||:|.:|.....|.|::..:..:..||:.|||||||:|....:|: 
plant   272 SAHWSR-DDIIASGAGDNAIRLFVDSKHDSVDGPSYNLLLKKNKAHENDVNSVQWSPGEGNRLLA 335

  Fly   321 SCSDDGTIKIWKV 333
            |.||||.:|||::
plant   336 SASDDGMVKIWQL 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ciao1NP_610996.1 WD40 6..332 CDD:238121 165/336 (49%)
WD40 9..>333 CDD:225201 165/337 (49%)
WD40 repeat 17..57 CDD:293791 17/49 (35%)
WD40 repeat 63..101 CDD:293791 23/38 (61%)
WD40 repeat 106..145 CDD:293791 29/39 (74%)
WD40 repeat 152..191 CDD:293791 21/43 (49%)
WD40 repeat 197..248 CDD:293791 19/51 (37%)
WD40 repeat 255..299 CDD:293791 13/44 (30%)
WD40 repeat 306..331 CDD:293791 15/26 (58%)
emb1345NP_565615.1 WD40 6..>352 CDD:225201 165/339 (49%)
WD40 12..347 CDD:238121 165/336 (49%)
WD40 repeat 23..71 CDD:293791 17/48 (35%)
WD40 repeat 78..116 CDD:293791 23/38 (61%)
WD40 repeat 121..160 CDD:293791 29/39 (74%)
WD40 repeat 167..206 CDD:293791 21/39 (54%)
WD40 repeat 216..263 CDD:293791 19/51 (37%)
WD40 repeat 270..313 CDD:293791 13/44 (30%)
WD40 repeat 320..346 CDD:293791 15/26 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H55850
Inparanoid 1 1.050 341 1.000 Inparanoid score I625
OMA 1 1.010
OrthoDB 1 1.010 D793298at2759
OrthoInspector 1 1.000 T125154
orthoMCL 1 0.900 OOG5_127906
Panther 1 1.100 LDO PTHR19920
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.