DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ciao1 and ciao1

DIOPT Version :8

Sequence 1:NP_610996.1 Gene:Ciao1 / 36655 FlyBaseID:FBgn0033972 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_012814508.1 Gene:ciao1 / 549641 XenbaseID:XB-GENE-1010751 Length:334 Species:Xenopus tropicalis

Alignment Length:317 Identity:181/318 (57%)
Similarity:227/318 (71%) Gaps:5/318 (2%)


  Fly    16 RIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWSTKTILSDGHKRTIREIRWSPCGQYLASASFD 80
            |.|.:||:|.|.:.||||.|:.||||...|:.|..|::|.:||:||:|::.|||||.||||||||
 Frog    18 RCWFLAWNPSGTLLASCGGDRTIRIWGKDGDNWVCKSVLGEGHQRTVRKVSWSPCGNYLASASFD 82

  Fly    81 ATTAIWSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCSRDKSVWIWEVAGDDEFECAAVLN 145
            |||.||.|...||||..||||||||||||:|:.||.||||||||||||:|||..::|:||.:|||
 Frog    83 ATTCIWMKKKEEFECITTLEGHENEVKSVAWAPSGSLLATCSRDKSVWVWEVDEEEEYECVSVLN 147

  Fly   146 PHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTVWGIDFDADGERLV 210
            .||||||.|||||.:::|||||||:::|::.||  ::||.|.|||..||||||.:.||..||:|.
 Frog   148 SHTQDVKHVVWHPNQELLASASYDDSVKLYREE--EDDWVCCATLEGHTSTVWSLAFDQTGEQLA 210

  Fly   211 SCSDDTTIKIWRAYHPGNTAGVATPDQQTVWKCVCTVSGQHSRAIYDVSWCKLTGLIATACGDDG 275
            :||||.|::|||....|...|..:...   ||||||::|.|:|.:|||:|..|||.||||||||.
 Frog   211 TCSDDKTVRIWRQLGTGEQVGSKSDPN---WKCVCTLTGYHTRTVYDVNWNHLTGAIATACGDDA 272

  Fly   276 IRIFKESSDSKPDEPTFEQITAEEGAHDQDVNSVQWNPVVAGQLISCSDDGTIKIWK 332
            :|||:|...|.|.:|||........||.||||.|.|:|.....|.||||||.:..|:
 Frog   273 VRIFEEDPGSDPLQPTFSLTAHMPRAHTQDVNCVTWHPKEPNLLASCSDDGEMAFWR 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ciao1NP_610996.1 WD40 6..332 CDD:238121 181/316 (57%)
WD40 9..>333 CDD:225201 181/318 (57%)
WD40 repeat 17..57 CDD:293791 18/40 (45%)
WD40 repeat 63..101 CDD:293791 27/38 (71%)
WD40 repeat 106..145 CDD:293791 27/39 (69%)
WD40 repeat 152..191 CDD:293791 22/39 (56%)
WD40 repeat 197..248 CDD:293791 23/51 (45%)
WD40 repeat 255..299 CDD:293791 24/44 (55%)
WD40 repeat 306..331 CDD:293791 12/25 (48%)
ciao1XP_012814508.1 WD40 17..329 CDD:238121 181/316 (57%)
WD40 repeat 19..59 CDD:293791 18/40 (45%)
WD40 22..>332 CDD:225201 179/314 (57%)
WD40 repeat 65..103 CDD:293791 27/38 (71%)
WD40 repeat 108..147 CDD:293791 27/39 (69%)
WD40 repeat 154..191 CDD:293791 22/39 (56%)
WD40 repeat 197..245 CDD:293791 23/51 (45%)
WD40 repeat 252..292 CDD:293791 24/40 (60%)
WD40 repeat 303..328 CDD:293791 12/25 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238105875
eggNOG 1 0.900 E1_KOG0645
Hieranoid 1 1.000
Homologene 1 1.000 H55850
Inparanoid 1 1.050 404 1.000 Inparanoid score I1748
OMA 1 1.010
OrthoDB 1 1.010 D365323at33208
OrthoFinder 1 1.000 FOG0005128
OrthoInspector 1 1.000 T1059122
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2069
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.