DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ciao1 and Ciao1

Sequence 1:NP_610996.1 Gene:Ciao1 FlyBaseID:FBgn0033972 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_079572.2 Gene:Ciao1 MGIID:1346998 Length:339 Species:Mus musculus

Alignment Length:330 Identity:194/331 (59%)
Similarity:242/331 (73%) Gaps:3/331 (1%)


  Fly     4 LILEHTLQGH-KGRIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWSTKTILSDGHKRTIREIRW 67
            |:|:..:..| ..|.|.:||:|.|.:.||||.|:.||||...|::|..|::||:||:||:|::.|
Mouse     5 LVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAW 69

  Fly    68 SPCGQYLASASFDATTAIWSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCSRDKSVWIWEV 132
            ||||.|||||||||||.||.|:..:|||..||||||||||||:|:.||.||||||||||||:|||
Mouse    70 SPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEV 134

  Fly   133 AGDDEFECAAVLNPHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTV 197
            ..:||:||.:||:.||||||.|||||::::|||||||:|:|::.||  .:||.|.|||..|.|||
Mouse   135 DEEDEYECVSVLSSHTQDVKHVVWHPSQELLASASYDDTVKLYQEE--GDDWVCCATLEGHESTV 197

  Fly   198 WGIDFDADGERLVSCSDDTTIKIWRAYHPGNTAGVATPDQQTVWKCVCTVSGQHSRAIYDVSWCK 262
            |.|.||..|:||.|||||.|::|||.|.|||..|||.......|||:||:||.|:|.||||:||:
Mouse   198 WSIAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHTRTIYDVAWCQ 262

  Fly   263 LTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEEGAHDQDVNSVQWNPVVAGQLISCSDDGT 327
            |||.:|||||||.||:|:|...|.|.:|||........||.||||.|.|||...|.|.||||||.
Mouse   263 LTGALATACGDDAIRVFEEDPGSDPQQPTFSLTAHLRQAHSQDVNCVAWNPKEPGLLASCSDDGE 327

  Fly   328 IKIWK 332
            :..|:
Mouse   328 VAFWE 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ciao1NP_610996.1 WD40 6..332 CDD:238121 193/327 (59%)
WD40 9..>333 CDD:225201 192/326 (59%)
WD40 repeat 17..57 CDD:293791 19/40 (48%)
WD40 repeat 63..101 CDD:293791 26/38 (68%)
WD40 repeat 106..145 CDD:293791 28/39 (72%)
WD40 repeat 152..191 CDD:293791 23/39 (59%)
WD40 repeat 197..248 CDD:293791 29/51 (57%)
WD40 repeat 255..299 CDD:293791 25/44 (57%)
WD40 repeat 306..331 CDD:293791 14/25 (56%)
Ciao1NP_079572.2 WD 1 14..53 19/40 (48%)
WD40 17..332 CDD:238121 190/315 (60%)
WD40 repeat 19..58 CDD:293791 19/39 (49%)
WD 2 59..98 26/39 (67%)
WD40 repeat 65..103 CDD:293791 26/38 (68%)
WD 3 103..142 30/39 (77%)
WD40 repeat 108..147 CDD:293791 27/39 (69%)
WD 4 148..187 24/39 (62%)
WD40 repeat 154..191 CDD:293791 21/37 (57%)
LYR motif, required for interaction with HSC20. {ECO:0000250|UniProtKB:O76071} 176..178 0/2 (0%)
WD 5 192..231 24/39 (62%)
WD40 repeat 197..248 CDD:293791 30/51 (59%)
WD 6 250..289 25/39 (64%)
WD40 repeat 255..295 CDD:293791 25/40 (63%)
WD 7 301..339 19/34 (56%)
WD40 repeat 306..331 CDD:293791 15/25 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238112164
eggNOG 1 0.900 E1_KOG0645
Hieranoid 1 1.000
Homologene 1 1.000 H55850
Inparanoid 1 1.050 436 1.000 Inparanoid score I1668
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005128
OrthoInspector 1 1.000 T1083103
orthoMCL 1 0.900 OOG5_127906
Panther 1 1.100 LDO PTHR19920
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.