DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ciao1 and SPAC806.02c

Sequence 1:NP_610996.1 Gene:Ciao1 FlyBaseID:FBgn0033972 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_592852.1 Gene:SPAC806.02c PomBaseID:SPAC806.02c Length:608 Species:Schizosaccharomyces pombe

Alignment Length:331 Identity:129/332 (39%)
Similarity:191/332 (58%) Gaps:18/332 (5%)


  Fly     9 TLQGHKGRIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWSTKTILSDGHKRTIREIRWSPCGQ- 72
            |:.||.||:|.||.||...:||:..:||::||::  .||::...::...|.|:||.:.|.|..: 
pombe   285 TISGHTGRLWSVAAHPMLPLFATSSQDKSVRIYN--SNTYNLVHVIDGFHTRSIRRVAWRPIERP 347

  Fly    73 YLASASFDATTAIWSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCSRDKSVWIWEVAGDDE 137
            .||.||||:..:|..|...::||.|.|||||||||.::||.:|..||||||||||||||...|||
pombe   348 VLAVASFDSVVSINEKIDDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIWEATEDDE 412

  Fly   138 FECAAVLNPHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTVWGIDF 202
            |:|.|||..||||||.|.||||:|:|.|.||||:|..:.::  .:||..|..|..||:|||.:.|
pombe   413 FDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDD--GDDWALTCQLQGHTNTVWALAF 475

  Fly   203 DADGERLVSCSDDTTIKIWRAYHPG------NTAGVATPDQQTVWKCVCTVSGQHSRAIYDVSWC 261
            ..:|..|.|..:|..:.:|......      ::..:..|..|..||...::...|..|:|.:||.
pombe   476 SPNGNTLASADNDGNVFLWIKISSNEDVATIDSTNILRPALQEEWKQQTSLPHIHKGAVYTISWM 540

  Fly   262 KLTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEEGAHD-QDVNSVQWNPVVAGQLISCSDD 325
            . ...:.:|.||..|.:::.   .|.||..:.....::.||. .::||:::  :...:|:|..||
pombe   541 N-DATLCSAGGDGKIVVYQR---EKHDEALWHVAYEQDHAHGVYEINSLEY--LRDDRLLSGGDD 599

  Fly   326 GTIKIW 331
            |..::|
pombe   600 GECRVW 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ciao1NP_610996.1 WD40 6..332 CDD:238121 129/332 (39%)
WD40 9..>333 CDD:225201 129/332 (39%)
WD40 repeat 17..57 CDD:293791 13/40 (33%)
WD40 repeat 63..101 CDD:293791 16/39 (41%)
WD40 repeat 106..145 CDD:293791 27/39 (69%)
WD40 repeat 152..191 CDD:293791 18/39 (46%)
WD40 repeat 197..248 CDD:293791 12/57 (21%)
WD40 repeat 255..299 CDD:293791 10/44 (23%)
WD40 repeat 306..331 CDD:293791 7/25 (28%)
SPAC806.02cNP_592852.1 ParA 3..269 CDD:287566
COG1149 8..246 CDD:224071
WD40 <283..608 CDD:225201 129/332 (39%)
WD40 283..606 CDD:238121 129/332 (39%)
WD40 repeat 293..330 CDD:293791 13/39 (33%)
WD40 repeat 337..376 CDD:293791 16/39 (41%)
WD40 repeat 381..420 CDD:293791 27/39 (69%)
WD40 repeat 427..464 CDD:293791 18/39 (46%)
WD40 repeat 470..507 CDD:293791 8/37 (22%)
WD40 repeat 534..575 CDD:293791 10/45 (22%)
WD40 repeat 582..605 CDD:293791 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I796
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.