DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ciao1 and Y18D10A.9

Sequence 1:NP_610996.1 Gene:Ciao1 FlyBaseID:FBgn0033972 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_493247.2 Gene:Y18D10A.9 WormBaseID:WBGene00012479 Length:337 Species:Caenorhabditis elegans

Alignment Length:345 Identity:145/346 (42%)
Similarity:201/346 (58%) Gaps:22/346 (6%)


  Fly     1 MGRLILEHTLQGHK---GRIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWS-----TKTILSDG 57
            |.|.|.|...||.|   .|:|...||..|.:.||||:|||:|:|||.|...|     .:|.|.|.
 Worm     1 MLRQIGEFYHQGEKDDTSRVWMTCWHHGGRILASCGDDKAVRVWSLVGEPDSKMRLECRTTLDDS 65

  Fly    58 HKRTIREIRWSPCGQYLASASFDATTAIWSKSSGEFECNATLEGHENEVKSVSWSRSGGLLATCS 122
            |.|.:|.:.:|..|:.|.||||||:..::.:..|||.....|||||:|||...:|:|...|||||
 Worm    66 HTRAVRSVAFSNDGKCLVSASFDASVVVYQQEDGEFAEVNKLEGHESEVKCAVFSKSDEFLATCS 130

  Fly   123 RDKSVWIWEVAGDDEFECAAVLNPHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCT 187
            ||||||.|:...|::|..:::|.|||||||:|.||||:|:|.|.|||::|:.:..:  ..||...
 Worm   131 RDKSVWFWQQDEDEDFSVSSILQPHTQDVKQVAWHPTEDLLVSCSYDSSIRFYRFD--GEDWVTQ 193

  Fly   188 ATLTS-HTSTVWGIDFDADGERLVSCSDDTTIKIWRAYHPGNTAGVATPDQQTVWKCVCTVSGQH 251
            ..:.. |..|||.|.||.:|.|||:..:|..|:::...:.|:.:.    ||.| ||.|.....::
 Worm   194 QKIDGCHVGTVWSIAFDTEGHRLVTVGEDHCIQLFVRENIGSKSA----DQDT-WKSVARYDVEN 253

  Fly   252 SR-AIYDVSWCKLTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEEGAHDQDVNSVQW--NP 313
            :| .:|.|:|.....:|||..||..||:||.|  |.|:.|..|.: ...|.|:.|||.|.|  ||
 Worm   254 TRWPLYSVAWNSTNDVIATGGGDCKIRLFKIS--STPESPVIEHL-GVVGRHELDVNHVAWNPNP 315

  Fly   314 VVAGQLISCSDDGTIKIWKV 333
            ..:..|.|.||||||::|::
 Worm   316 KFSNLLTSASDDGTIRLWEL 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ciao1NP_610996.1 WD40 6..332 CDD:238121 142/338 (42%)
WD40 9..>333 CDD:225201 141/336 (42%)
WD40 repeat 17..57 CDD:293791 20/45 (44%)
WD40 repeat 63..101 CDD:293791 15/38 (39%)
WD40 repeat 106..145 CDD:293791 19/39 (49%)
WD40 repeat 152..191 CDD:293791 15/39 (38%)
WD40 repeat 197..248 CDD:293791 18/51 (35%)
WD40 repeat 255..299 CDD:293791 17/44 (39%)
WD40 repeat 306..331 CDD:293791 14/27 (52%)
Y18D10A.9NP_493247.2 WD40 <14..336 CDD:225201 139/333 (42%)
WD40 17..334 CDD:238121 138/327 (42%)
WD40 repeat 25..64 CDD:293791 18/39 (46%)
WD40 repeat 71..109 CDD:293791 15/38 (39%)
WD40 repeat 114..153 CDD:293791 19/39 (49%)
WD40 repeat 160..197 CDD:293791 15/39 (38%)
WD40 repeat 204..250 CDD:293791 18/51 (35%)
WD40 repeat 258..300 CDD:293791 17/45 (38%)
WD40 repeat 306..333 CDD:293791 14/27 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C237643846
eggNOG 1 0.900 E1_KOG0645
Hieranoid 1 1.000
Homologene 1 1.000 H55850
Inparanoid 1 1.050 259 1.000 Inparanoid score I1912
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D365323at33208
OrthoFinder 1 1.000 FOG0005128
OrthoInspector 1 1.000 T474687
orthoMCL 1 0.900 OOG5_127906
Panther 1 1.100 LDO PTHR19920
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2069
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.