DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC2 and C44C10.10

DIOPT Version :10

Sequence 1:NP_610995.1 Gene:SMC2 / 36653 FlyBaseID:FBgn0027783 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_509954.1 Gene:C44C10.10 / 183458 WormBaseID:WBGene00008090 Length:127 Species:Caenorhabditis elegans


Alignment Length:61 Identity:18/61 - (29%)
Similarity:28/61 - (45%) Gaps:14/61 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FKSYGRRTEIEGFDPEFTAITGLNGSGKSNILDSICFVLGISNLQNVRASALQDLVYKNGQ 71
            ::|:|:          .|.|||.||.|||.::.:|    ||.....|..|:.|....:.|:
 Worm    67 YESFGK----------ITTITGPNGCGKSALVRAI----GILTGDEVTESSNQQYAVRFGK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC2NP_610995.1 SMC_N 2..1162 CDD:481474 18/61 (30%)
C44C10.10NP_509954.1 COG3950 50..>126 CDD:443150 18/61 (30%)

Return to query results.
Submit another query.