DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and ANTR2

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_567175.2 Gene:ANTR2 AraportID:AT4G00370 Length:541 Species:Arabidopsis thaliana

Alignment Length:490 Identity:141/491 (29%)
Similarity:219/491 (45%) Gaps:112/491 (23%)


  Fly     3 QVEARTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLE 67
            |...|.|:..:.|..|::..|.|:|::|.|:.|        |.|                     
plant   127 QFPRRWVIVLLCFSSFLLCNMDRVNMSIAILPM--------SQE--------------------- 162

  Fly    68 RWFLDWANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFG-----WSNGI 127
                           ::|:....|.:..||||.:...||.|||.|.|:|.|:|.|     ||   
plant   163 ---------------YNWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVLGFGVVWWS--- 209

  Fly   128 GVFCCFLIPIVSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSK-----FVSAYLGS 187
              |...:.||.:......|:::|.|.|...|:|.|:|:.:.:||||.:|||:     :...||||
plant   210 --FATIMTPIAARLGLPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLGS 272

  Fly   188 SVGVALFYPI----FGYIIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIE 248
            ..|:| |.|:    ||       |..|:|..|.:|::||:.|....:.||.:.|.:::.|:|.| 
plant   273 VTGLA-FSPMLITKFG-------WPSVFYSFGSLGSIWFLLWLKFAYSSPKDDPDLSEEEKKVI- 328

  Fly   249 KSLGASIQGSKGP------TPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIR 307
              ||    ||| |      .|||.|.:..|||..:::.:...||.|.|:|..|||:..:..:|:.
plant   329 --LG----GSK-PREPVTVIPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLT 386

  Fly   308 ATGFLSGLPHLMRMLFAYVFSIFADYLLRTDKMSRTNVRKLATFICCGTKGLI--VLALAYFGYN 370
            .:|.|..||.|...:||.:....||.|: :..:|.|||||:...|     |.:  ...|:...:.
plant   387 ESGLLCVLPWLTMAVFANIGGWIADTLV-SRGLSITNVRKIMQSI-----GFLGPAFFLSQLSHV 445

  Fly   371 ATAAIVLVTVATMLHGA---VSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHN 432
            .|.|:.::.:|.. .|:   ..||..::..|:.|.|||::||:|...|.:.|.......|.:...
plant   446 KTPAMAVLCMACS-QGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQR 509

  Fly   433 NQTIDAWKNVF-----------LLTSLMLTGSGIL 456
            .    :|.:||           |:.:|..||..||
plant   510 G----SWDDVFKVAVALYLIGTLVWNLFATGEKIL 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 141/491 (29%)
MFS 76..460 CDD:119392 128/418 (31%)
ANTR2NP_567175.2 MFS 135..534 CDD:119392 134/475 (28%)
2A0114 142..529 CDD:273326 132/463 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D497052at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11662
Phylome 00.000 Not matched by this tool.
44.120

Return to query results.
Submit another query.