DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and PHT4;1

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_180526.1 Gene:PHT4;1 AraportID:AT2G29650 Length:512 Species:Arabidopsis thaliana

Alignment Length:469 Identity:130/470 (28%)
Similarity:202/470 (43%) Gaps:79/470 (17%)


  Fly     7 RTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLERWFL 71
            |.|:..:.|..|::..|.|:|::|.|:.|.|..|                               
plant   102 RWVIVLLCFSAFLLCNMDRVNMSIAILPMSAEYG------------------------------- 135

  Fly    72 DWANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFG-----WSNGIGVFC 131
                         ||....|.:..||||.:...||.|||.|...|.|.|.|     ||     ..
plant   136 -------------WNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKRVLGFGVIWWS-----IA 182

  Fly   132 CFLIPIVSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSK-----FVSAYLGSSVGV 191
            ..|.|:.:......|:::|.|.|...|:|.|:|:.:.:||:|..|||:     :...||||..|:
plant   183 TILTPVAAKLGLPYLLVVRAFMGVGEGVAMPAMNNILSKWVPVQERSRSLALVYSGMYLGSVTGL 247

  Fly   192 ALFYPIFGYIIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQ 256
            | |.|   ::|....|..|:|..|.:||:|...|......||.|.|.:...|||.|     |...
plant   248 A-FSP---FLIHQFGWPSVFYSFGSLGTVWLTLWLTKAESSPLEDPTLLPEERKLI-----ADNC 303

  Fly   257 GSKGPT---PWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHL 318
            .||.|.   ||:.|.:..|||..:...:...||.|.|:|..|||:..:..:|:..:|.||..|.:
plant   304 ASKEPVKSIPWRLILSKPPVWALISCHFCHNWGTFILLTWMPTYYHQVLKFNLMESGLLSVFPWM 368

  Fly   319 MRMLFAYVFSIFADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNATAAIVLVTVATM 383
            ...:.|......||.|: :...|.|||||:...|........:..|.:.. :.|.|::.:..:..
plant   369 TMAISANAGGWIADTLV-SRGFSVTNVRKIMQTIGFLGPAFFLTQLKHID-SPTMAVLCMACSQG 431

  Fly   384 LHGAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLT-S 447
            ......||..::..|::|.|:|::||:|...|.:.|.:.....|.:..:.    :|.:||.:: .
plant   432 TDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVLGTAATGHILQHG----SWDDVFTISVG 492

  Fly   448 LMLTGSGILYVLFS 461
            |.|.|: :::.|||
plant   493 LYLVGT-VIWNLFS 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 130/470 (28%)
MFS 76..460 CDD:119392 116/398 (29%)
PHT4;1NP_180526.1 MFS 106..504 CDD:119392 126/463 (27%)
MFS_1 108..471 CDD:284993 118/423 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D497052at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11662
Phylome 00.000 Not matched by this tool.
44.120

Return to query results.
Submit another query.