DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and slc17a9a

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_001336574.1 Gene:slc17a9a ZFINID:ZDB-GENE-081021-1 Length:458 Species:Danio rerio

Alignment Length:401 Identity:92/402 (23%)
Similarity:166/402 (41%) Gaps:50/402 (12%)


  Fly    83 FHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPIVSYWSYTGLI 147
            |.|::.:.|.:||:|||.:...|:.||..:.:.|.:.|...|.........|.||::....:.|:
Zfish    78 FEWSKTETGMVLGAFFWGYCFTQVVGGHASDRIGGERVLLLSTSSWGIMTALTPILAKTGLSPLL 142

  Fly   148 IL---RVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAY-LGSSVGVALFYPIFGYIIDWTRWE 208
            .:   |...|.:.|:.:||:..:.::.:...||...:|.. .|..:|:.|...:...::||..|:
Zfish   143 TMTASRFLLGVMQGVHYPSLVSICSQRVTEGERGLLMSTLACGCYLGMMLVGGVGSLMLDWFGWQ 207

  Fly   209 WVYYICGIVGTLW-FIAWQFLVFDSPAEHPRIADS---ERKFIEKSLGASIQGSKGPTPWKAIAT 269
            .|:|..|::...| ...|:.|:..:...    .||   .||.:.:|...:         |..:..
Zfish   208 SVFYGAGLLAVFWACCVWKCLLQGTDIS----LDSLWISRKDVSESSRIN---------WLYLLR 259

  Fly   270 SRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLF-------AYVF 327
            ...||..::|........:|||:..||:|:             ...||....:|       |...
Zfish   260 EPSVWAMIIAHLCFSSSYYTLMSWLPTFFK-------------DTFPHAKDWVFNVIPWFVALPT 311

  Fly   328 SIF----ADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNATAAIVLVTVATMLHGAV 388
            |:|    :|:|:| .......||||..|...|...:.:|.|.... :...|:..|:|...|....
Zfish   312 SLFGGSISDHLIR-QGCGTAAVRKLMQFCSMGVASVFILFLCKTS-SFIQAVACVSVTIGLSTFH 374

  Fly   389 SSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLMLTGS 453
            :||...::.|.:|:.||.:.||........|.:..:|.|.:.   :...:|.|||.:.:|:....
Zfish   375 NSGVSVNVNDQAPSCAGALYGVMNTCAAFTGLLMVYISGYMI---EVTGSWVNVFSVLALVNVIG 436

  Fly   454 GILYVLFSESK 464
            ..:::...|:|
Zfish   437 VAVFITLGEAK 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 92/402 (23%)
MFS 76..460 CDD:119392 90/396 (23%)
slc17a9aXP_001336574.1 MFS 50..443 CDD:119392 90/396 (23%)
MFS_1 53..407 CDD:284993 83/357 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.