DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and CG2003

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_651903.2 Gene:CG2003 FlyBaseID:FBgn0039886 Length:492 Species:Drosophila melanogaster

Alignment Length:499 Identity:138/500 (28%)
Similarity:228/500 (46%) Gaps:69/500 (14%)


  Fly    13 MTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLERWFLDWANIP 77
            :.|.|...|.::::|:::.:|.|        :|||..|::|                      .|
  Fly    23 LLFYGLAANTVLQLNVSVAVVAM--------TNETTSNNSD----------------------PP 57

  Fly    78 YEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPIVSYWS 142
            :    ::|:|:::..:|.|::|.....|.|.|.|..::|:|.|..|.. :|  ...|..:.:|..
  Fly    58 H----YNWSEEKKSYILSSYYWGCALAQFPAGYLCKRFGSKAVLFWGT-LG--SSLLSALTTYGV 115

  Fly   143 YTG----LIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKF-VSAYLGSSVGVALFYPIFGYII 202
            |.|    ...:|:.|| :..:.||.:|...|.|.|..||::. ..||.|...|..|.....|.|.
  Fly   116 YAGGWKAYCAIRLLQG-LCQVTWPCIHQHLANWCPTAERTRLGAFAYTGFDCGNVLAMYGAGMIA 179

  Fly   203 DWT-RWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQGS--KGP--- 261
            ..: .|..:.|....:|.:|...|..|..:..::...|.::|:.:|.    ..||.|  |||   
  Fly   180 SSSLGWPGISYSAAGLGLIWCGLWLLLGANKASDARFIGEAEKAYIV----GDIQRSERKGPKKM 240

  Fly   262 -TPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAY 325
             .|||.|.||.||:..:.|:....|||.|:.|..|||...:...::::....|.||.|:..:..|
  Fly   241 EIPWKGIFTSVPVYALLCARCADSWGLTTMQTELPTYLSGVLKLDMKSNAVFSALPFLLMWVMCY 305

  Fly   326 VFSIFADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGY-NATAAIVLVTVATMLHGAVS 389
            |:.|.||.|||...||.|.:||..|.|.......|:|:|...|. ..|..:||||::..:..|.:
  Fly   306 VYLIIADVLLRKKWMSLTTLRKTYTSIALWAPASIMLSLVIVGEGQKTLVLVLVTLSVGVSSAAT 370

  Fly   390 SGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLMLTGSG 454
            .|...:.:|||||:|||:.|:......:...::|.:||.|..:......|:.||.|.:.:|....
  Fly   371 IGSELNTIDLSPNHAGILAGLMSSFTNLMALLTPLVVGVLVTDPSQRSQWQIVFSLAAGVLFTGN 435

  Fly   455 ILYVLFSESKLQPWNSGCHQLPDSGLKELQNLGRDQDDEEEKKP 498
            ::::::..:..||||..         ||.:     ::.|.|:||
  Fly   436 VIFLIWGTAVTQPWNES---------KESR-----RELEPEEKP 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 132/474 (28%)
MFS 76..460 CDD:119392 117/397 (29%)
CG2003NP_651903.2 2A0114euk 23..456 CDD:129972 134/484 (28%)
MFS 58..441 CDD:119392 116/395 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1799
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000029
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11662
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.