DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and MFS9

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_650889.1 Gene:MFS9 FlyBaseID:FBgn0038799 Length:502 Species:Drosophila melanogaster

Alignment Length:499 Identity:139/500 (28%)
Similarity:242/500 (48%) Gaps:55/500 (11%)


  Fly     7 RTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLERWFL 71
            |.::..:.|.||...|.:|:||::.||       |:|.|.|..::.                   
  Fly    38 RYIVVLLAFFGFFNVYSLRVNLSVAIV-------AMTENRTVFDAD------------------- 76

  Fly    72 DWANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIP 136
              .|:.|::: |.|:.||:|.:|.|||:.:...|..||.:.||.|..:|||...|.......|.|
  Fly    77 --GNVSYQQD-FPWDSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTP 138

  Fly   137 IVSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVS-AYLGSSVGVALFYPIFGY 200
            :.:..|....:.:|:.:|:..|:.:|.:|.:.|:|.||.|||:..| |:.|:..|..:..|..|:
  Fly   139 MAASHSLEMFLFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGF 203

  Fly   201 IIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQGSKG-PTPW 264
            :.....||.|:|:.|.:|.:|:|.|...|...|......:..|..:|:|::|  ..|||. ..||
  Fly   204 LATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTIG--YVGSKHVKHPW 266

  Fly   265 KAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAYVFSI 329
            :||.||.|.:..:.:.:...||.:||:|..|::.|...::::..||.||.:|:|...:...|...
  Fly   267 RAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGY 331

  Fly   330 FADYLLRTDKMSRTNVRKLATFICCG--TKGLIVLALAYFGYNATAAIVLVTVATMLHGAVSSGP 392
            .||:|......:.|.||:  .|.|..  .:.:.::..||. .:.|.::|.:|:|..|.....||.
  Fly   332 LADWLQVKGIWTTTQVRR--NFNCGAFLAQTVFMMLTAYL-LDPTWSVVSLTIAVGLGAFAWSGF 393

  Fly   393 LASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTS-LMLTGSGIL 456
            ..:.:|::|.:|.:::|:......:||.:||.:.|.:. .|||.|.|:.:|.::: :.|.|. ::
  Fly   394 AVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVV-TNQTSDEWRIIFFISAGIYLVGC-VI 456

  Fly   457 YVLFSESKLQPWNSGCHQLPDSGLKELQNLGRDQDDEEEKKPLK 500
            |..:....||.|    .:.|:...:|          .|||..|:
  Fly   457 YWFYCSGDLQEW----AKTPEQKAQE----------AEEKAQLQ 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 133/472 (28%)
MFS 76..460 CDD:119392 115/389 (30%)
MFS9NP_650889.1 2A0114euk 38..477 CDD:129972 134/479 (28%)
MFS 42..460 CDD:119392 129/454 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1799
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D497052at2759
OrthoFinder 1 1.000 FOG0000029
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11662
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.