DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and ppt1

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_998504.1 Gene:ppt1 ZFINID:ZDB-GENE-040426-2653 Length:303 Species:Danio rerio

Alignment Length:173 Identity:34/174 (20%)
Similarity:62/174 (36%) Gaps:48/174 (28%)


  Fly   127 IGVFCCFLIPIVSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFV-SAYLGSSVG 190
            :.|..|.|:...:.|:..|.:.|.::.|.......|.......|.:.......:| |..:|.|| 
Zfish    10 LSVSGCLLLLCGTSWASNGTVPLVIWHGMGDSCCNPLSMGAIKKMVEQEVSGIYVLSLMIGKSV- 73

  Fly   191 VALFYPIF-----GYIIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKS 250
                   |     |:::|..:  .|.::|                |..|:.|::.:         
Zfish    74 -------FEDTENGFLMDVNK--QVSFVC----------------DQLAKDPKLKE--------- 104

  Fly   251 LGASIQG-SKGPTPWKAIATSRP-----VWLNVVAQWGGIWGL 287
             |.:..| |:|....:|:|...|     ..::|..|..|::||
Zfish   105 -GYNAMGFSQGAQFLRAVAQRCPDPPMRNLISVGGQHQGVYGL 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 34/174 (20%)
MFS 76..460 CDD:119392 34/174 (20%)
ppt1NP_998504.1 Abhydrolase 30..302 CDD:304388 29/154 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.