DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and MFS15

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_611375.2 Gene:MFS15 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster

Alignment Length:519 Identity:159/520 (31%)
Similarity:236/520 (45%) Gaps:89/520 (17%)


  Fly    13 MTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLERWFLDWANIP 77
            :.|.|..|.|.:|:||::.||.|           |..|:::                    .:.|
  Fly    33 LVFFGLAVAYSLRVNLSVAIVAM-----------TDRNASN--------------------PDFP 66

  Fly    78 YEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPIVSYW- 141
                .|.|||..:..||.||||.:...|||||.|:..||.|.:..:    ||..|..:.:::.: 
  Fly    67 ----EFDWNESTKSYLLSSFFWGYVVTQIPGGYLSAIYGAKYMLFY----GVLICSCLALLTPFC 123

  Fly   142 ----SYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVS-AYLGSSVGVALFYPIFGYI 201
                .:|.:::||..||...|:.:||.|...:||.|..||.:.|. .|.||..|..:...:.|||
  Fly   124 AVNGGWTVVVVLRAVQGLCQGVIFPSTHTFLSKWAPAEERGRLVGYTYSGSQFGTVVMLSVSGYI 188

  Fly   202 IDWT-RWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQGSKG----- 260
            ...: .|...:||.|.||.:|...|.:|...:||:||.|..:||:|||.|..|......|     
  Fly   189 ASSSLGWPSTFYIPGCVGIVWSFVWLYLCSSTPAQHPTITPNERRFIESSGQARRPSDAGREEQP 253

  Fly   261 --PTPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLF 323
              ||||..|.||.|..:.|:|.....||.:||:|..||:.:.:...:|:..|.||.||:...:|.
  Fly   254 RPPTPWWRIFTSVPFLVLVLAHCANNWGFWTLLTEIPTFMKNVLGMDIKNNGPLSALPYFAMILL 318

  Fly   324 AYVFSIFADYLLRTDKMSRTNVRKLATFICCG-------TKG--LIVLALAYFGY------NATA 373
            ..||...:|.|           ::..|.|..|       |.|  |.:|||...||      |...
  Fly   319 TCVFIWLSDTL-----------KQRGTVIPLGFSRKFFNTLGMWLPMLALIGLGYITEGEANVRL 372

  Fly   374 AIVLVTVATMLHGAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDA 438
            ||.|:|.|...:.|...|...:.:||||||||.::|::.........::|.|||.:..:......
  Fly   373 AIGLLTAAVATNSATYLGFHVNHIDLSPNYAGTLMGITNCAANFMSILAPLIVGLIVWDETNPAQ 437

  Fly   439 WKNVFLLTSLMLTGSGILYVLFSESKLQPWNS-GCHQLPDSGLKELQNLGRDQDDE--EEKKPL 499
            |:.||..|:.:.....:|::||..:::||||| ...:.|..|       |..:.||  |::.||
  Fly   438 WRIVFFFTAFVYFIGNLLFMLFGRTRVQPWNSRPTTRTPSPG-------GGGERDEGTEDRGPL 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 151/491 (31%)
MFS 76..460 CDD:119392 133/413 (32%)
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 150/486 (31%)
MFS 31..459 CDD:119392 145/476 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1799
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D497052at2759
OrthoFinder 1 1.000 FOG0000029
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11662
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.