DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NaPi-T and MFS18

DIOPT Version :9

Sequence 1:NP_001260981.1 Gene:NaPi-T / 36651 FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster


Alignment Length:420 Identity:100/420 - (23%)
Similarity:180/420 - (42%) Gaps:65/420 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLV-----FGWSNGIGVFCCFLI 135
            :|...:...|::...|.:|.||||.:...|:.||..:.::|.:.|     .|||     ...||:
  Fly    51 VPAVASAQKWSKTDSGTVLSSFFWGYTLTQVVGGYFSDRFGGQRVILFAAIGWS-----LITFLM 110

  Fly   136 PIV-----SYWSYT--GLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAY-LGSSVGVA 192
            |.:     |..||.  .::.:|:..|.:.|:.:|||..||::.:.|||||.|.... .||::|..
  Fly   111 PTIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQNLCPNERSSFFGLLTAGSALGTL 175

  Fly   193 LFYPIFGYIIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQG 257
            |...:..:::|:..|.:|:.:.|::|..|.:..::..         :|....:.|..:..:.:..
  Fly   176 LTGIMGSFLLDYFGWSYVFRVIGLMGIAWALVLRYYA---------MAGERNRIINIATPSRLCA 231

  Fly   258 SKGP-----TPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPH 317
            :|.|     .||.........|..|:.....:...|.|::..||||.             .|.||
  Fly   232 NKSPAETSAVPWLRYFRRLSFWACVLTHACEMNCFFVLLSWLPTYFH-------------DGFPH 283

  Fly   318 -------LMRMLFAYVFSIFADYL---LRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNAT 372
                   ::..|.....::||.||   |...:...|.|||:....|...:.|.:..::......|
  Fly   284 AKGWVVNMIPWLALPPCTLFAKYLTTRLLAREWHTTTVRKVIQSCCFAAQNLALFVMSRTSDFHT 348

  Fly   373 AAIVLVTV--ATMLH-GAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQ 434
            |.|.:..:  .|..| .||:..|    .||:|.::|.|.|:...:|.:|||:..::.|.:....|
  Fly   349 ALICMTIIIGGTGFHNNAVTVNP----QDLAPLHSGSVFGLMNTVGAIPGFLGVYLAGHILELTQ 409

  Fly   435 TIDAWKNVFLLTSLMLTGSGILYVLFSESK 464
               :|..||...:.:.....|::::|..::
  Fly   410 ---SWPMVFSAAAGINLVGWIIFIVFGSAE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 100/420 (24%)
MFS 76..460 CDD:119392 99/414 (24%)
MFS18NP_608835.1 MFS 30..432 CDD:119392 99/414 (24%)
MFS_1 32..397 CDD:284993 93/376 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.