DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and Slc17a4

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_795990.2 Gene:Slc17a4 MGIID:2442850 Length:492 Species:Mus musculus

Alignment Length:469 Identity:133/470 (28%)
Similarity:216/470 (46%) Gaps:34/470 (7%)


  Fly    13 MTFIGFIVNYMI---RINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLERW--FLD 72
            :.||..:.|:.|   ::||:..|..|:         .|...|:.|.|..|.....|.:.|  .|.
Mouse    36 LAFILHLCNFSIYTQQMNLSFAITAMV---------NTTVASSQLNASTERPPTNSQDVWNETLQ 91

  Fly    73 WANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPI 137
            .:..|.    :.|..:.||.||.|..:..:...||.|.:|..:|.|.|.|....|.......||:
Mouse    92 ESKAPV----YDWTPEIQGILLSSLSYGSFIAPIPTGYVAGVFGAKYVVGLGLLISSVLTLFIPL 152

  Fly   138 VSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVS-AYLGSSVGVALFYPIFGYI 201
            .:......||:|||.||....:.....:.|.|||.||.|||:.:: |..||.:|..|.....|.|
Mouse   153 AADAGVALLIVLRVIQGMAQVMVLTGQYSLWAKWAPPQERSQLITIAASGSMLGTFLVLIAGGLI 217

  Fly   202 IDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFI-------EKSLGASIQGSK 259
            .....|.:::||.|.:|....:.|..||:|.|..||.|:..||::|       :.|||.|:    
Mouse   218 CQALGWPYIFYIFGGIGCACCLLWFPLVYDDPQNHPFISTGERRYITCSLAQEDCSLGWSL---- 278

  Fly   260 GPTPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFA 324
               |.||:..|.|:|..||:.:...|.|.|:|.:.|||...:...|:|.:|.||.||.:...:..
Mouse   279 ---PIKAMVKSLPLWAIVVSYFCEYWLLSTVMAYTPTYISSVLQANLRDSGILSALPFMFGCVCI 340

  Fly   325 YVFSIFADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNATAAIVLVTVATMLHGAVS 389
            .:..:.||:||....:....:|||.|.:.......|:|.|.:...:.:..:..:.::::......
Mouse   341 ILGGLLADFLLSRKILRLVTIRKLFTAVGVLASSGILLPLPWVRSSRSTTMAFLVLSSVFASLCD 405

  Fly   390 SGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLMLTGSG 454
            ||.|.:.:|::|.|||.:.|:..:...:.|.|:|.:.|.....:... .|:|||.|.:.:.....
Mouse   406 SGALINFLDIAPRYAGFLKGLLQVFSYLAGGIAPTVAGFFISQDSEF-GWRNVFFLAAAIDVVGL 469

  Fly   455 ILYVLFSESKLQPW 468
            :.|::||.:::|.|
Mouse   470 LFYLIFSRAEVQDW 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 133/470 (28%)
MFS 76..460 CDD:119392 113/392 (29%)
Slc17a4NP_795990.2 2A0114euk 27..486 CDD:129972 133/470 (28%)
MFS 98..475 CDD:119392 112/385 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11662
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.