DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and Slc17a8

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_006241302.1 Gene:Slc17a8 RGDID:628870 Length:608 Species:Rattus norvegicus

Alignment Length:513 Identity:149/514 (29%)
Similarity:252/514 (49%) Gaps:61/514 (12%)


  Fly     4 VEARTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLER 68
            :..|.::..|:.:||.:::.||.||.:.||:|:            .|||                
  Rat    92 IPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMV------------NNST---------------- 128

  Fly    69 WFLDWANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCF 133
            .::| .....:...|:|:.:..|.:.|||||.:...|||||.::.|:....|||.:..:......
  Rat   129 VYVD-GKPEIQTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNM 192

  Fly   134 LIPIVSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKF-VSAYLGSSVGVALFYPI 197
            .||..:...|..::.:|:.||.:.|:.:|:.|.:.:||.||.|||:. .:::.||..|..:..|:
  Rat   193 FIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPL 257

  Fly   198 FGYIIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLG-----ASIQG 257
            .|.::.:..|..|:||.|:.|.:|::.|....::.||.||.|::.||.:||.|:|     ||:  
  Rat   258 AGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAVHPTISNEERTYIETSIGEGANLASL-- 320

  Fly   258 SKGPTPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRML 322
            ||..|||:...||.||:..:||.:...|..:.|:...|.||..:..:.|...|.||.:||::..:
  Rat   321 SKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTI 385

  Fly   323 FAYVFSIFADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNAT--AAIVLVTVATMLH 385
            ...:....||||.....::.|.|||:..   ||..|:....|...|::.|  .||..:.:|....
  Rat   386 VVPIGGQLADYLRSRKILTTTAVRKIMN---CGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFS 447

  Fly   386 GAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLML 450
            |...||...:.:|::|.||.|::|:|..:|.:.|.:.|.|||.:| .::|.:.|:||||:.:|:.
  Rat   448 GFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMT-KHKTREEWQNVFLIAALVH 511

  Fly   451 TGSGILYVLFSESKLQPWNSGCHQLPDSGLKELQNLGR------DQDDEEEKKPLKSD 502
            ....|.|.:|:..:.|.|            .:.:||..      |||:..|:..|..:
  Rat   512 YSGVIFYGVFASGEKQDW------------ADPENLSEEKCGIIDQDELAEETELNHE 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 142/478 (30%)
MFS 76..460 CDD:119392 124/392 (32%)
Slc17a8XP_006241302.1 2A0114euk 95..533 CDD:129972 142/485 (29%)
MFS 100..522 CDD:119392 139/457 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D497052at2759
OrthoFinder 1 1.000 FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.