DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and SLC17A8

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_647480.1 Gene:SLC17A8 HGNCID:20151 Length:589 Species:Homo sapiens

Alignment Length:527 Identity:148/528 (28%)
Similarity:258/528 (49%) Gaps:56/528 (11%)


  Fly     7 RTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLERWFL 71
            |.::..|:.:||.:::.||.||.:.||:|:            .|||                .::
Human    75 RYIIAIMSGLGFCISFGIRCNLGVAIVEMV------------NNST----------------VYV 111

  Fly    72 DWANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIP 136
            | .....:...|:|:.:..|.:.|||||.:...|||||.::.|:....|||.:..:.......||
Human   112 D-GKPEIQTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIP 175

  Fly   137 IVSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKF-VSAYLGSSVGVALFYPIFGY 200
            ..:...|..::.:|:.||.:.|:.:|:.|.:.:||.||.|||:. .:::.||..|..:..|:.|.
Human   176 SAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV 240

  Fly   201 IIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGAS---IQGSKGPT 262
            ::.:..|..|:||.|:.|.:|::.|....::.||.||.|::.|:.:||.|:|..   :..||..|
Human   241 LVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSKFST 305

  Fly   263 PWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAYVF 327
            |||...||.||:..:||.:...|..:.|:...|.||..:..:.|...|.||.:||::..:...:.
Human   306 PWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIG 370

  Fly   328 SIFADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNAT--AAIVLVTVATMLHGAVSS 390
            ...||||.....::.|.|||:..   ||..|:....|...|::.|  .||..:.:|....|...|
Human   371 GQLADYLRSRQILTTTAVRKIMN---CGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAIS 432

  Fly   391 GPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLMLTGSGI 455
            |...:.:|::|.||.|::|:|..:|.:.|.:.|.|||.:| .::|.:.|:||||:.:|:.....|
Human   433 GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMT-RHKTREEWQNVFLIAALVHYSGVI 496

  Fly   456 LYVLFSESKLQPWNSGCHQLPDSGLKELQNLGRDQ----DDEEEKKPLKSDHDK-ETPIVAEQET 515
            .|.:|:..:.|.|            .:.:||..::    |.:|..:.::.:|:. .:|.......
Human   497 FYGVFASGEKQEW------------ADPENLSEEKCGIIDQDELAEEIELNHESFASPKKKMSYG 549

  Fly   516 KTKSDCD 522
            .|..:|:
Human   550 ATSQNCE 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 140/473 (30%)
MFS 76..460 CDD:119392 122/390 (31%)
SLC17A8NP_647480.1 2A0114euk 75..513 CDD:129972 140/483 (29%)
MFS 80..502 CDD:119392 137/455 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D497052at2759
OrthoFinder 1 1.000 FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.