| Sequence 1: | NP_001260981.1 | Gene: | NaPi-T / 36651 | FlyBaseID: | FBgn0016684 | Length: | 524 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006516679.1 | Gene: | Slc17a1 / 20504 | MGIID: | 103209 | Length: | 498 | Species: | Mus musculus | 
| Alignment Length: | 450 | Identity: | 135/450 - (30%) | 
|---|---|---|---|
| Similarity: | 209/450 - (46%) | Gaps: | 34/450 - (7%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    25 RINLNITIVDMIAGKGA-ITSNETHENSTDLAALAEMNERFSLERWFLDWANIPYEKNGFHWNEK 88 
  Fly    89 QQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPIVSYWSYTGLIILRVFQ 153 
  Fly   154 GWITGLAWPSMHVLTAKWIPPNERSKFVSAYL-GSSVGVALFYPIFGYIIDWTRWEWVYYICGIV 217 
  Fly   218 GTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQGSKGPTPWKAIATSRPVWLNVVAQWG 282 
  Fly   283 GIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAYVFSIFA----DYLLRTDKMSRT 343 
  Fly   344 NVRKLATFICCGTKGLIVLALAYFGYNATAAIVLVTVATMLHGAVSSGPLASMVDLSPNYAGIVL 408 
  Fly   409 GVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLMLTGSGILYVLFSESKLQPW 468 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| NaPi-T | NP_001260981.1 | 2A0114euk | 1..474 | CDD:129972 | 134/449 (30%) | 
| MFS | 76..460 | CDD:119392 | 117/388 (30%) | ||
| Slc17a1 | XP_006516679.1 | 2A0114euk | 34..497 | CDD:129972 | 134/449 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2532 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000034 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||