DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and Slc17a1

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_006516679.1 Gene:Slc17a1 MGIID:103209 Length:498 Species:Mus musculus

Alignment Length:450 Identity:135/450 (30%)
Similarity:209/450 (46%) Gaps:34/450 (8%)


  Fly    25 RINLNITIVDMIAGKGA-ITSNETHENSTDLAALAEMNERFSLERWFLDWANIPYEKNGFHWNEK 88
            |:.||:|:|.|:...|: ..|||         ::.||          ||....|.    :.|:..
Mouse    68 RVCLNLTMVAMVNNTGSPHLSNE---------SVVEM----------LDNVKNPV----YSWSPD 109

  Fly    89 QQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPIVSYWSYTGLIILRVFQ 153
            .||.:|.|.|:....:|.|.|.|:..|..|.:.|.|..:......|:|..:......:|:.||.|
Mouse   110 IQGLILSSVFFGMVVVQAPVGYLSGIYPMKRIIGSSLFLSSLMSLLLPPAAQVGAALVIVCRVLQ 174

  Fly   154 GWITGLAWPSMHVLTAKWIPPNERSKFVSAYL-GSSVGVALFYPIFGYIIDWTRWEWVYYICGIV 217
            |...|......|.:..||.||.||.:..|..| |..:|..:...:.|:|.|...|..|:||.|||
Mouse   175 GIAQGTVSTGQHEIWVKWAPPLERGRLTSMTLSGFVMGPFIVLLVSGFICDLLGWPMVFYIFGIV 239

  Fly   218 GTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQGSKGPTPWKAIATSRPVWLNVVAQWG 282
            |.:..::|.||.||.|.:||.::.||:.:|..||.......:...|.||:..|.|:|..::..:.
Mouse   240 GCVLSLSWFFLFFDDPKDHPYMSSSEKDYIISSLMQQASSGRQSLPIKAMLKSLPLWAIILNSFA 304

  Fly   283 GIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAYVFSIFA----DYLLRTDKMSRT 343
            .||....|:|:.||:...:.|.|:|..|.||.||:|:    ||:..|.|    |:.|.....|..
Mouse   305 FIWSNSLLVTYTPTFISTVLHVNVRENGLLSSLPYLL----AYICGILAGQMSDFFLTRKIFSIV 365

  Fly   344 NVRKLATFICCGTKGLIVLALAYFGYNATAAIVLVTVATMLHGAVSSGPLASMVDLSPNYAGIVL 408
            .||||.|.:......:.::.|.|..||..:.::.:|:|.........|.|.:.:|::|.|.|.:.
Mouse   366 TVRKLFTTLGSFCPVIFIMCLLYLSYNFYSTVIFLTLANSTLSFSYCGQLINALDIAPRYYGFLK 430

  Fly   409 GVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLMLTGSGILYVLFSESKLQPW 468
            .|:.:||...|.||..:.| |..|.....||..:|.|.:.:.....:.|.||::.::|.|
Mouse   431 AVTALIGMFGGLISSTLAG-LILNQDPEYAWHKIFFLMAGINVTCLVFYFLFAKGEIQDW 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 135/450 (30%)
MFS 76..460 CDD:119392 118/389 (30%)
Slc17a1XP_006516679.1 2A0114euk 34..497 CDD:129972 135/450 (30%)
MFS 104..482 CDD:119392 118/383 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11662
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.