DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and Y19D10A.11

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001303757.1 Gene:Y19D10A.11 WormBaseID:WBGene00021226 Length:465 Species:Caenorhabditis elegans

Alignment Length:481 Identity:114/482 (24%)
Similarity:198/482 (41%) Gaps:82/482 (17%)


  Fly     7 RTVLWYM-------TFIGFIVNYMIRINLNITIV---DMIAGKGAITS-NETHENSTDLAALAEM 60
            ||.|:.|       |||     .|..:..|.|::   |::.....:|: .:||            
 Worm    27 RTRLYIMVLTLACLTFI-----QMNTLTFNFTVICMEDIVEDYNLLTNYTDTH------------ 74

  Fly    61 NERFSLERWFLDWANIPYEKNGFHWNEKQ---QGALLGSFFWAHWTLQIPGGILATKYGTKLVFG 122
                    ||        |:|    .||.   .||.:|.....     ||...|.:..|...|..
 Worm    75 --------WF--------ERN----TEKSLLFSGAAIGGLIGL-----IPAVPLISSLGLGNVQT 114

  Fly   123 WSNGIGVFCCFLIPI-VSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAYLG 186
            .|..|..|..||.|: ||...||.| :.|:.||..:.:.:.::.|:...|.|.||.:.|: |.|.
 Worm   115 ISGIISAFGAFLFPLAVSIGFYTSL-LCRILQGVGSAIMFTTVGVVPGVWAPSNEANTFM-AILS 177

  Fly   187 SSVGVA--LFYPIFGYIIDWT-RWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIE 248
            .::.::  :..|:.|.:.:.. .|..:||:.|.:..:.:|.:.|...|.|..|..::..|   :.
 Worm   178 CALQLSNIICMPVSGLLCESALGWRSIYYLFGGLTFIIYIVFWFTYSDDPKLHRNVSQKE---LG 239

  Fly   249 KSLGASIQGSKGPTPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLS 313
            |.....|:..|.|.|:.||.|...|.:...:.:||....|.|..:.|||.|.|..:::|.|||||
 Worm   240 KISTGKIEKIKEPVPYLAICTDPTVLITWTSCFGGNMAFFALSLYGPTYLREILKFDVRETGFLS 304

  Fly   314 GLPHLMRMLFAYVFSIFADYLLRTDKMSRTNVRKLATFICCGTK-----GLIVLALAYFGYNATA 373
            .||.::    :.:....|..|  :|:|:..:.:....|....::     ||:|:|   |..:...
 Worm   305 ALPFIL----SAIVKFGAGQL--SDRMTFLSEKARFVFFAATSQIGFAVGLVVMA---FTSDRLI 360

  Fly   374 AIVLVTVATMLHGAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDA 438
            |.:....|.:..|....|.:..:......:....:.|......:..|::|.||..:..:| |.:.
 Worm   361 AQIAFNFAIVSSGLNIMGVIKCIQLRCRQHVHFAIAVISFTAYVVQFLAPIIVSIICPDN-TPEQ 424

  Fly   439 WKNVFLLTS--LMLTGSGILYVLFSE 462
            |..:||..:  :::..:|..::..|:
 Worm   425 WTILFLFITGVIIVCNAGFPFITRSD 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 114/482 (24%)
MFS 76..460 CDD:119392 97/398 (24%)
Y19D10A.11NP_001303757.1 MFS 80..439 CDD:119392 94/379 (25%)
MFS_1 80..410 CDD:284993 86/349 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.