DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and W04C9.6

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_490737.2 Gene:W04C9.6 WormBaseID:WBGene00021028 Length:459 Species:Caenorhabditis elegans

Alignment Length:487 Identity:110/488 (23%)
Similarity:194/488 (40%) Gaps:52/488 (11%)


  Fly    23 MIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLERWFLDWANIPYEKNGFHWNE 87
            |:...:.:..:.:|.....:||..::.|:.:...:...::..:      ..:.:.|.|:  ..|.
 Worm     1 MVNSPVPVRFLILICATLCLTSILSNMNTYNFTKICMQDDNST------STSKVNYTKS--ESNF 57

  Fly    88 KQQGALLGSFFWAHWTLQIPGGILATKYGTKLVF---GWSNGIGVFCCFLIPIVSYWSYTGLIIL 149
            .|....:||.     ...||..|.......|.||   |..:|:..   .|||:.|...|...:..
 Worm    58 LQSCVAIGSL-----AASIPFSISFQHLPHKPVFIVAGIISGVST---ALIPLASTIGYGWFVAA 114

  Fly   150 RVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAYLGSSVGVALF-YPIFGYIIDWT-RWEWVYY 212
            |:.||......:|....:||.|..|.|...|:....|::....:| .|:.|::...: .|..|||
 Worm   115 RICQGMAFSATFPLAGSITANWATPYEHGVFIGLLTGNTQLSNIFTMPVSGWLCSSSGGWTSVYY 179

  Fly   213 ICGIVGTLWFIAWQFLVFD-SPAEHPRIADSERKFI-EKSLGASIQGSKGPTPWKAIATSRPVWL 275
            :...|..:.|..: ||.|. ||:||..:.:.|.:.| |...|..:...|. .|::.|.||..:|.
 Worm   180 VHAGVSLVTFSLF-FLFFKCSPSEHSWVGEKELERIREGKSGKKVSRPKN-LPFRHILTSLSLWA 242

  Fly   276 NVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAYVFSIFADYLLRTDKM 340
            ..:|.:|.:..:..:....|.|.:...::::.::|||:.||.:.:........|.:||:   ..:
 Worm   243 CWIASFGDLITVQLVSQFNPQYMKNYLNYDVLSSGFLAALPIIFQFFTKLSSGIISDYI---KFI 304

  Fly   341 SRTNVRKLATFICCGTKGLIVLALAYFGYNA-TAAIVLVTVATMLHGAVSSGPLASMVDLSPNYA 404
            |.|...|:...|......:..:.||:..... ..||:::..|..:.|..::|........|..||
 Worm   305 SETLKTKIFNTIALAVAAVFFIVLAFIPQEKHLLAIIIMICAESVMGCNTAGFNKCATLHSQQYA 369

  Fly   405 GIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLMLTGSGILYVLFSESKLQPWN 469
            ...:.....|.....||.||.|..:. .:.|...|:|.||..:.:|.....::.||:::....|.
 Worm   370 YFAMQQIMNIWACTIFIEPFFVNMIV-TDDTFTDWRNCFLAHAGLLLFVNTIFCLFADASPAKWT 433

  Fly   470 SGCHQLPDSGLKELQNLGRDQDD----EEEKK 497
                              |.|||    ||||:
 Worm   434 ------------------RLQDDDVAIEEEKE 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 102/459 (22%)
MFS 76..460 CDD:119392 95/392 (24%)
W04C9.6NP_490737.2 2A0114euk 14..432 CDD:129972 100/440 (23%)
MFS 49..424 CDD:119392 95/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.