DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NaPi-T and slc-17.5

Sequence 1:NP_001260981.1 Gene:NaPi-T FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_505139.1 Gene:slc-17.5 WormBaseID:WBGene00017681 Length:530 Species:Caenorhabditis elegans

Alignment Length:407 Identity:87/408 (21%)
Similarity:171/408 (42%) Gaps:36/408 (9%)


  Fly    83 FHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPIVS-YWSYTGL 146
            |.|:...||.::.:.|...:....|.|:|..::..:.:...:..:......|:|::| |....|.
 Worm   115 FIWSVSWQGYIVSAAFLGGFIFSYPAGVLVDRFSARHILSVAILMLTIASLLMPVLSIYIGEKGA 179

  Fly   147 IILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAY---------LGSSVGVALFYPIFGYII 202
            ...|...|....:..||::.:..||||.||:|...|.:         .|:.:...|....||   
 Worm   180 FAGRFVMGISETMLIPSINSMVTKWIPINEKSLAASVFTAGNQLSGMFGNILVAELCASSFG--- 241

  Fly   203 DWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQGSKGP------ 261
                |..::|...:.|..|.:.|...|.:||.....|...|..::..::     ..|.|      
 Worm   242 ----WSSIFYSASLFGISWLVLWHLTVRNSPHNTRWIHKRELDYLANNI-----PPKHPSSVVKK 297

  Fly   262 TPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAYV 326
            |||:.:.||:..|..:.....|...:..:..:.|.||:.:...::::.||.|.:||:..::...:
 Worm   298 TPWRDMLTSKVFWSLMFNSVMGNMMIALIFVYIPVYFKDVLMLDVQSNGFYSAIPHISNLIAKLI 362

  Fly   327 FSIFADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNATA----AIVLVTVATMLHGA 387
            :....|.:.....:|.:...||:.|  ....|:.| :..:..|...|    |:||::..:...|.
 Worm   363 WGYLMDKMRHKKILSPSATVKLSQF--ASMMGISV-SCFFLRYMNCATPFYALVLLSSVSAFFGL 424

  Fly   388 VSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTSLMLTG 452
            ..||...|::.::|::.|.:..::.:||.:....:|.::... ....|.:.|.:|.|:.......
 Worm   425 SISGFYTSLLSIAPSHIGTLTSLATVIGFVGRMFTPLMISYY-KTVGTAEEWGHVLLIYVFASAT 488

  Fly   453 SGILYVLFSESKLQPWN 469
            .||:::||....:|.|:
 Worm   489 GGIIFLLFGSGDVQNWD 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 87/408 (21%)
MFS 76..460 CDD:119392 84/397 (21%)
slc-17.5NP_505139.1 2A0114euk 64..510 CDD:129972 87/408 (21%)
MFS 107..496 CDD:119392 84/397 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D497052at2759
OrthoFinder 1 1.000 FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11662
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.