| Sequence 1: | NP_001260981.1 | Gene: | NaPi-T / 36651 | FlyBaseID: | FBgn0016684 | Length: | 524 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_741396.1 | Gene: | Y4C6B.4 / 177312 | WormBaseID: | WBGene00021158 | Length: | 458 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 496 | Identity: | 112/496 - (22%) | 
|---|---|---|---|
| Similarity: | 201/496 - (40%) | Gaps: | 77/496 - (15%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     9 VLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLERWFLDW 73 
  Fly    74 ANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFLIPIV 138 
  Fly   139 SYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAYLG-SSVGVALFYPIFGYII 202 
  Fly   203 DWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLG-ASIQ-GSKGPTPWK 265 
  Fly   266 AIATSRPVWLNV-VAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAYVFSI 329 
  Fly   330 FADYLLRTDKMSRTNV-RKLATFICCGTKGLIVLALAYFG-----YNATAAIVLVTVATMLH--- 385 
  Fly   386 ------GAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFL 444 
  Fly   445 LTSLMLTGSGILYVLFSESKLQPWNSGCHQLPDSGLKELQN 485 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| NaPi-T | NP_001260981.1 | 2A0114euk | 1..474 | CDD:129972 | 109/483 (23%) | 
| MFS | 76..460 | CDD:119392 | 93/402 (23%) | ||
| Y4C6B.4 | NP_741396.1 | MFS | 15..432 | CDD:391944 | 106/469 (23%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||