| Sequence 1: | NP_001260981.1 | Gene: | NaPi-T / 36651 | FlyBaseID: | FBgn0016684 | Length: | 524 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_316621.3 | Gene: | AgaP_AGAP006594 / 1277177 | VectorBaseID: | AGAP006594 | Length: | 490 | Species: | Anopheles gambiae | 
| Alignment Length: | 503 | Identity: | 147/503 - (29%) | 
|---|---|---|---|
| Similarity: | 251/503 - (49%) | Gaps: | 58/503 - (11%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     7 RTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNET--HENSTDLAALAEMNERFSLERW 69 
  Fly    70 FLDWANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFCCFL 134 
  Fly   135 IPIVSYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVS-AYLGSSVGVALFYPIF 198 
  Fly   199 GYIIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGASIQG--SKGP 261 
  Fly   262 TPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPHLMRMLFAYV 326 
  Fly   327 FSIFADYLLRTDKMSRTNVRKLATFICCGT--KGLIVLALAYFGYNATAAIVLVTVATMLHGAVS 389 
  Fly   390 SGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTS-LMLTGS 453 
  Fly   454 GILYVLFSESKLQPWNSGCHQLPDSGLKELQNLGRDQDDEEEKKPLKS 501 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| NaPi-T | NP_001260981.1 | 2A0114euk | 1..474 | CDD:129972 | 144/474 (30%) | 
| MFS | 76..460 | CDD:119392 | 122/389 (31%) | ||
| AgaP_AGAP006594 | XP_316621.3 | 2A0114euk | 25..465 | CDD:129972 | 144/489 (29%) | 
| MFS | 29..448 | CDD:119392 | 139/455 (31%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D497052at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000034 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||