DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs31 and trpp-5

DIOPT Version :8

Sequence 1:NP_610986.1 Gene:Trs31 / 36641 FlyBaseID:FBgn0266723 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_496593.1 Gene:trpp-5 / 190338 WormBaseID:WBGene00013259 Length:185 Species:Caenorhabditis elegans

Alignment Length:180 Identity:101/181 (56%)
Similarity:138/181 (76%) Gaps:0/181 (0%)


  Fly    12 MRPRSNILDRPLSKGKTEVSQSIVALLFSEIVQYSQSRVFTVPELQTRLHDLGQDVGTRIIDLYF 76
            |...:.|||:.||:||||::.|..|:||||:|.|:|:|..||.::..::...|:.||.|:.|:..
 Worm     1 MAKTTGILDKSLSRGKTEINLSTFAVLFSEMVLYAQNRSETVTDIHDKIASYGKQVGLRMFDIIT 65

  Fly    77 VRERSSKRETKLTQMLLFVKTTVWKNLFGKEAEKLEHANDDERTYYIIEKEPLVNTFISVPKDKG 141
            :||:..||||||..||:|:|:|||||||||||:|||.:|||..||.:|||:|:|||:||||:|||
 Worm    66 LREKGYKRETKLLGMLMFIKSTVWKNLFGKEADKLERSNDDHCTYLLIEKDPMVNTYISVPRDKG 130

  Fly   142 SLNCANFTAGIVEAVLTNCGFPCKVTAHWHKGTTYMVKFEDFVIARDKQM 191
            .||||.|.||||||:|.:..|.||||||||.||.|:::|::.||||:..:
 Worm   131 VLNCAAFAAGIVEAILESASFKCKVTAHWHNGTAYVIQFDESVIARENSL 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs31NP_610986.1 COG5128 5..188 CDD:227457 101/176 (57%)
TRAPPC5_Trs31 30..181 CDD:271346 87/151 (58%)
trpp-5NP_496593.1 TRAPPC5_Trs31 19..170 CDD:271346 87/151 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235579905
eggNOG 1 0.900 E1_COG5128
Hieranoid 1 1.000
Homologene 1 1.000 H5754
Inparanoid 1 1.050 218 1.000 Inparanoid score I2271
Isobase 1 0.950 0 Normalized mean entropy S869
OMA 1 1.010
OrthoDB 1 1.010 D1279541at2759
OrthoFinder 1 1.000 FOG0004379
OrthoInspector 1 1.000 T474379
orthoMCL 1 0.900 OOG5_128074
Panther 1 1.100 LDO PTHR20902
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1556
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.