DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs31 and trpp-5

DIOPT Version :9

Sequence 1:NP_610986.1 Gene:Trs31 / 36641 FlyBaseID:FBgn0266723 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_496593.1 Gene:trpp-5 / 190338 WormBaseID:WBGene00013259 Length:185 Species:Caenorhabditis elegans


Alignment Length:180 Identity:101/180 - (56%)
Similarity:138/180 - (76%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MRPRSNILDRPLSKGKTEVSQSIVALLFSEIVQYSQSRVFTVPELQTRLHDLGQDVGTRIIDLYF 76
            |...:.|||:.||:||||::.|..|:||||:|.|:|:|..||.::..::...|:.||.|:.|:..
 Worm     1 MAKTTGILDKSLSRGKTEINLSTFAVLFSEMVLYAQNRSETVTDIHDKIASYGKQVGLRMFDIIT 65

  Fly    77 VRERSSKRETKLTQMLLFVKTTVWKNLFGKEAEKLEHANDDERTYYIIEKEPLVNTFISVPKDKG 141
            :||:..||||||..||:|:|:|||||||||||:|||.:|||..||.:|||:|:|||:||||:|||
 Worm    66 LREKGYKRETKLLGMLMFIKSTVWKNLFGKEADKLERSNDDHCTYLLIEKDPMVNTYISVPRDKG 130

  Fly   142 SLNCANFTAGIVEAVLTNCGFPCKVTAHWHKGTTYMVKFEDFVIARDKQM 191
            .||||.|.||||||:|.:..|.||||||||.||.|:::|::.||||:..:
 Worm   131 VLNCAAFAAGIVEAILESASFKCKVTAHWHNGTAYVIQFDESVIARENSL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs31NP_610986.1 TRAPPC5_Trs31 30..181 CDD:271346 86/150 (57%)
trpp-5NP_496593.1 TRAPPC5_Trs31 19..170 CDD:271346 86/150 (57%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 1 1.000 - -
eggNOG 1 0.900 - -
Hieranoid 1 1.000 - -