DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and msantd1

DIOPT Version :8

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001314777.1 Gene:msantd1 / 798497 ZFINID:ZDB-GENE-121227-1 Length:274 Species:Danio rerio

Alignment Length:275 Identity:58/276 (21%)
Similarity:101/276 (37%) Gaps:69/276 (25%)


  Fly    68 RNPNFDTDETKLLIQLWGDPKLQRTLITTHKKHAVICQLAAKMQEY---GYHRSPEEITTRIKNL 129
            |..|:...|.|.|:.:|.:   ..|.:...|::|.|.:..|| |.|   |..|..|||..:|.|:
Zfish    21 RARNWTDSEMKALVYIWEE---YVTELKKAKRNAKIYETMAK-QLYELTGEQRHREEIKMKITNM 81

  Fly   130 KCFYNRLKKDKECGGQSTDSEPSWKHFAEMDAIMTR----------------PIFSVRPNEVP-- 176
            ...:.:||.... ||.||   |.|.::..::.|:::                |..|.....||  
Zfish    82 TFQFRKLKYTAN-GGSST---PDWPYYKSIERILSKVPDHGHMSPPNLSSSGPSTSQHDPAVPQS 142

  Fly   177 APSLKYQLEQALEEHAERRKRRLANGEELSESDNEEDDM-----------------------LLS 218
            ||...:     |.|:....:.|..|.|:...:||.....                       :|.
Zfish   143 APPSGF-----LPEYTGSSEERDMNDEDDGLTDNSASSFETRSQPHKRRRLSHVSLRRKKLRVLD 202

  Fly   219 ALVSKNKDTGGRKELEAGCLEADSDMNEESFSKRRKVSADVEVDIGEALTSPCIKIEPGQEVET- 282
            |::.:.:...  ..:|..|.|....|::::|.:.:      .:.:.|.:.:...|:.|.|...: 
Zfish   203 AMLKEQRRIS--HAVEEACHEVRRVMHQQNFLQVQ------SLQLQERMMNLLEKMIPAQSAPSW 259

  Fly   283 ---AAATSTVEPQQE 294
               |:|.....|..|
Zfish   260 PNPASAKGLGTPTPE 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 28/92 (30%)
msantd1NP_001314777.1 Myb_DNA-bind_4 22..105 CDD:290549 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.