DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and CG14005

DIOPT Version :8

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_608959.1 Gene:CG14005 / 33808 FlyBaseID:FBgn0031739 Length:317 Species:Drosophila melanogaster

Alignment Length:338 Identity:55/339 (16%)
Similarity:109/339 (32%) Gaps:127/339 (37%)


  Fly    76 ETKLLIQLWGD-----PKLQRTLITTHKKHAVICQLAAKMQEYGYHRSPEEITTRIKNLKCFYNR 135
            |..:|::||.:     |.....|       .:..::|..:|:.|...:.:|...||.:   :.|:
  Fly    16 EEAMLLRLWREHLHAIPSYTDNL-------PIFREIAHGLQQNGVRLNKQEARRRINS---YRNK 70

  Fly   136 LKKDKECGGQSTDSEPSWKHFAEMDAIM-----TRPIF-------SVRPN---EVPA-PSLKYQL 184
            ...|:...|.:.:....|:.:|.:|.:.     :..:|       ::|..   ::|| |.|.|..
  Fly    71 YLNDRNRVGGNANFAKDWRLYALIDCLFCPAWPSSALFHFRNVLETIRATARVDLPALPPLLYTS 135

  Fly   185 EQALEEHAERRKRRLANGEELSESDNEEDDMLLSALVSKNKDTGGRKELEAGCLEADSDMNEESF 249
            ...|:                .|.|:|                        ||...|:       
  Fly   136 PAQLK----------------FERDSE------------------------GCTFLDA------- 153

  Fly   250 SKRRKVSADVEVDIGEALTSPCIKIEPGQEVETAAATSTVEPQQEEEDDDCMILPQPKEEPIDVD 314
                           :.|....:|.||                          ||....:.::::
  Fly   154 ---------------QPLVPAVVKTEP--------------------------LPDEHHQLVNIE 177

  Fly   315 AADD-PPIEKSSSSTTNTSTLADMLQGNKPSNLLPFTGANVIIPASITTTTAG-TSATTQSSTTT 377
            .... ..:|.::|.....:|...::|.:      |.|.||.|:|.:......| |:.....:..:
  Fly   178 YKPTVTQLENAASHYLERATAESVIQRS------PLTPANHILPEAEDAPYGGHTNGGQTDAERS 236

  Fly   378 SSKLQGGKISLVP 390
            :||.:.|:.|::|
  Fly   237 ASKRRRGRRSILP 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 17/87 (20%)
CG14005NP_608959.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22666
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.