DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and Paics

DIOPT Version :8

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_572826.1 Gene:Paics / 32228 FlyBaseID:FBgn0020513 Length:429 Species:Drosophila melanogaster

Alignment Length:222 Identity:38/223 (17%)
Similarity:77/223 (35%) Gaps:57/223 (26%)


  Fly   374 STTTSSKLQGGKISLV---------------PANFLMQSKLPAAAGPSPMANAKGAAPQIQLLQS 423
            ||||::.::|.|:..|               |...|:.||....||..  ..|...|.:.::..:
  Fly     2 STTTTASIEGYKLGKVIIEGKTKQVYDLPEQPGLCLLLSKDRITAGDG--VKAHDLAGKAEISNT 64

  Fly   424 AINQGARLMISGSAAAPAQPSNAGLVATAPGGVKFVLVNAEQAKAAAAAAAVGKSTASLPLS-TA 487
            ...|..||:           :.||             :.....|...|.|.:.:....:|:. ..
  Fly    65 TNGQVFRLL-----------NEAG-------------IRTAYVKQCGAKAFIARKCQMIPIEWVT 105

  Fly   488 QAQVQAAVQQQQQKLHQSLQQEQHHQQHIQLEKEESRHDHEKGRKDLQTKRHMTSMRILLRQLLN 552
            :.....:..::...:.:..:.....|:  ...|:::.||.:      .::..:.|.:..|..|:.
  Fly   106 RRLATGSFLKRNVGVPEGYRFSPPKQE--TFFKDDANHDPQ------WSEEQIVSAKFELNGLVI 162

  Fly   553 SQNEANEIQHNRL----SLERERLDWE 575
            .|:|.:.::...|    .|||.   |:
  Fly   163 GQDEVDIMRRTTLLVFEILERA---WQ 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549
PaicsNP_572826.1 SAICAR_synt_Ade5 12..260 CDD:133471 33/213 (15%)
purE 271..424 CDD:273474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001152
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.