DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10151 and pacs-1

DIOPT Version :8

Sequence 1:NP_001137670.1 Gene:CG10151 / 36639 FlyBaseID:FBgn0033960 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_494771.1 Gene:pacs-1 / 173772 WormBaseID:WBGene00015116 Length:423 Species:Caenorhabditis elegans

Alignment Length:461 Identity:95/462 (21%)
Similarity:160/462 (35%) Gaps:123/462 (27%)


  Fly   121 EITTRIKNLKCFYNRLKKDKECGGQSTDSEPSWKHFAEMDAIMTR------PIFSVRPNEVPAPS 179
            ||.:|.:||:.......|      |..|.:      .|.|.::.|      ...:||.||:...|
 Worm     6 EIASRPENLELLAEGKTK------QIFDIK------GEKDYVLIRSKDSLTAFNAVRKNELEGKS 58

  Fly   180 ----------LKYQLEQALEEHAER---------RK----------RRLANGEELSESDNEED-- 213
                      .:|.....|..|.|:         ||          ||:|.|..|..:...::  
 Worm    59 RIASKTTSNVFEYLQLLGLPTHFEKSISETEFVARKCTMIPIEWVARRVATGSFLKRNPGVKEGF 123

  Fly   214 ---DMLLSALV--SKNKDTGGRKE--LEAGCLEADSDMNEESFSKRRKVSADV--EVDIGEALTS 269
               |:.|....  ..|.|.....|  :..|.:.....:..|..|..:|::..|  .::.|.||::
 Worm   124 RFNDLKLETFFKDDANDDPQWTDEQIVSNGLMIDHLKIGREEISLMKKMTKLVFRALEKGWALSN 188

  Fly   270 PCI---KIEPGQEVETAAATSTVEPQQEEEDDDCMILPQ-------PKEEPIDVDAADDPPIEKS 324
            ..:   |||.|..||.....:.|     .::|...:.|:       .|:...|:....:..:...
 Worm   189 SALIDMKIEFGVTVEGEILLADV-----IDNDSWRVWPENDRRLQLDKQVYRDMKEVTEEGLALV 248

  Fly   325 SSSTTNTSTL-ADMLQGNKPSNLLPF--TGANVIIPASITTTTA--GTSATTQSST---TTSSKL 381
            ..:.|....: |...:..:..::|..  :|::.:....|:....  |...|.:.|:   |||..|
 Worm   249 LKNYTKVMDITATFSKHQQKCHVLVIMGSGSDGVFARKISDEAKKFGLETTLKVSSAHKTTSDTL 313

  Fly   382 QGGKISLVPANFLMQSKLP----AAAGPSPMANAKGAAPQIQLLQSAINQGARLMISGSAAAPA- 441
            :      |.|:| .:|.:|    |.||.|     .|..|               :|:|:::.|. 
 Worm   314 E------VIADF-EESGVPTVVIAVAGRS-----NGLGP---------------VIAGNSSLPVI 351

  Fly   442 ---QPSNAGLV-----ATAPGGV--KFVLVNAEQAKAAAAAAAVGKSTASLPLSTAQAQVQAAVQ 496
               .||.:..:     ...|.|:  ..||..:|.|.|||...|.........:.|||.:.|..:.
 Worm   352 NCPPPSESTSLDIWSSLRMPNGIGCTTVLDPSEAALAAAKILASHNHIVFGKVLTAQLKNQINIY 416

  Fly   497 QQQQKL 502
            ...:||
 Worm   417 NANRKL 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10151NP_001137670.1 Myb_DNA-bind_4 69..158 CDD:290549 8/37 (22%)
pacs-1NP_494771.1 SAICAR_synt_Ade5 15..259 CDD:133471 47/261 (18%)
purE 271..423 CDD:273474 42/180 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001152
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.