DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn6 and COPS2

DIOPT Version :9

Sequence 1:NP_725412.2 Gene:Rpn6 / 36638 FlyBaseID:FBgn0028689 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001137359.1 Gene:COPS2 / 9318 HGNCID:30747 Length:450 Species:Homo sapiens


Alignment Length:403 Identity:95/403 - (23%)
Similarity:177/403 - (43%) Gaps:48/403 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSVNREEQDSSLLNKLVRDQEGAENDEERIRIKEQGILQ-QGELYKQEGKAKELADLIKVT---- 90
            |..:..|.:..|.|:....:...|:|.:......|.:|: :||  |.|...|.|..:||:.    
Human    21 SEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGE--KGEWGFKALKQMIKINFKLT 83

  Fly    91 ---------RPFL----SSISKAKAAKLVRSLVDMFLDMDAGTGIEVQLCKDCIEWAKQEKRTFL 142
                     :..|    |::::..:.|.:.|::|........:..   ||:  ::..::...|.|
Human    84 NFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQNSDF---LCQ--MDLLQEFYETTL 143

  Fly   143 RQSLEARLIALYFDT-----ALYTEALALG--AQLLRELKK----------LDDKNLLVEVQLLE 190
            ....:|:...|:|.|     .||.|....|  .::||:|.:          |.....|:|:..||
Human   144 EALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALE 208

  Fly   191 SKTYHALSNLPKARAALTSARTTANAIYCP-PKVQGALDLQSGILHAADERDFKTAFSYFYEAFE 254
            .:.|.|..|..|.:|....:....:||  | |.:.|.:....|.:|.. |.:|:.|.:.|:|||:
Human   209 IQMYTAQKNNKKLKALYEQSLHIKSAI--PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFK 270

  Fly   255 GFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLADF 319
            .:|...|.:..|.|||::|..:::  ...:|...|.:.....:..:|.||.::..|.....:.:|
Human   271 NYDESGSPRRTTCLKYLVLANMLM--KSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEF 333

  Fly   320 QAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQ 384
            :..||.....:.:|..::.|:..|...:..|.|.::|:||:|:.:..:::.:.:.:..||..|.|
Human   334 EKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQ 398

  Fly   385 MILDKKFSGILDQ 397
            .|||....|.:||
Human   399 CILDNTIHGRIDQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn6NP_725412.2 RPN6 18..438 CDD:227488 95/403 (24%)
PCI 302..406 CDD:279707 25/96 (26%)
COPS2NP_001137359.1 RPN6 40..441 CDD:227488 91/384 (24%)
PCI 316..420 CDD:396121 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.