DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn6 and CSN1a

DIOPT Version :9

Sequence 1:NP_725412.2 Gene:Rpn6 / 36638 FlyBaseID:FBgn0028689 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster


Alignment Length:188 Identity:40/188 - (21%)
Similarity:68/188 - (36%) Gaps:42/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFS 247
            |:.|.:.....:|.|:.:.:|:.........|.      :|...|...:|:.|.. .:.:|:|..
  Fly   183 LIRVSIYMENWWHVLTYIDEAKQYAYGFENLAQ------EVPARLSCVAGLAHLG-LKIYKSAAQ 240

  Fly   248 YFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDI--------DAM 304
            ||.....|....|.:.|                .:||. |.:|..|:....|:.        :|.
  Fly   241 YFLSTPYGRYDYDKIVA----------------PEDVT-LYAGLCALATFDRETLQLNAINSEAF 288

  Fly   305 KSVAEASHK--RSLADFQAA--------LKEYKKELAEDVIVQAHLGTLYDTMLEQNL 352
            |...:.|.|  ..||.|.|.        |:|.:..:..||.:..|:..|||.::.:.|
  Fly   289 KPFFQLSPKMWTILAKFYAGEFDACMTLLREIENHVRLDVYLSPHVSALYDLIMARML 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn6NP_725412.2 RPN6 18..438 CDD:227488 40/188 (21%)
PCI 302..406 CDD:279707 17/61 (28%)
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 23/121 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.