DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AttA and AttB

Sequence 1:NP_523745.1 Gene:AttA FlyBaseID:FBgn0012042 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001163152.1 Gene:AttB FlyBaseID:FBgn0041581 Length:218 Species:Drosophila melanogaster

Alignment Length:221 Identity:210/222 (95%)
Similarity:214/222 (96%) Gaps:3/222 (1%)


  Fly     1 MQNTSILIVALVALFAITEALPTTGPIRVRRQVLGGSLTSNPAGGADARLDLTKGIGNPNHNVVG 65
            ||.|||||   :|||||.||:|||||||||||||||||.|||||||||||:|:||||||||||||
  Fly     1 MQKTSILI---LALFAIAEAVPTTGPIRVRRQVLGGSLASNPAGGADARLNLSKGIGNPNHNVVG 62

  Fly    66 QVFAAGNTQSGPVTTGGTLAYNNAGHGASLTKTHTPGVKDVFQQEAHANLFNNGRHNLDAKVFAS 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    63 QVFAAGNTQSGPVTTGGTLAYNNAGHGASLTKTHTPGVKDVFQQEAHANLFNNGRHNLDAKVFAS 127

  Fly   131 QNKLANGFEFQRNGAGLDYSHINGHGASLTHSNFPGIGQQLGLDGRANLWSSPNRATTLDLTGSA 195
            ||||||||||||||||||||||||||.||||||||||||||||||||||||||||||||||||||
  Fly   128 QNKLANGFEFQRNGAGLDYSHINGHGGSLTHSNFPGIGQQLGLDGRANLWSSPNRATTLDLTGSA 192

  Fly   196 SKWTSGPFANQKPNFGAGLGLSHHFG 221
            ||||||||||||||||||||||||||
  Fly   193 SKWTSGPFANQKPNFGAGLGLSHHFG 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AttANP_523745.1 Attacin_N 34..99 CDD:281725 62/65 (95%)
Attacin_C 101..220 CDD:281726 118/119 (99%)
AttBNP_001163152.1 Attacin_N 31..96 CDD:281725 62/65 (95%)
Attacin_C 98..217 CDD:281726 118/119 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134153595
eggNOG 1 0.900 E1_2EXDN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR38333
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.