DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jef and SP1173

DIOPT Version :8

Sequence 1:NP_001246323.1 Gene:jef / 36634 FlyBaseID:FBgn0033958 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_648053.1 Gene:SP1173 / 38744 FlyBaseID:FBgn0035710 Length:741 Species:Drosophila melanogaster

Alignment Length:830 Identity:156/830 - (18%)
Similarity:247/830 - (29%) Gaps:312/830 - (37%)


  Fly   111 RELIPVKSFYFFFYAAFGSLFPLMGVYFKQMGMNPGQCGILVGMRPFVEFLSAPFWGSYADRCRQ 175
            :.||.:|...||......:|..|.......:|:|..:...:..:.|||..|.....|.:|||...
  Fly    13 KTLISLKFVVFFVITGLTALHVLHATKPLLLGLNFSEYRTITILAPFVSILGPLIAGPWADRLAA 77

  Fly   176 ------GKR--------LLLGSLACWVLFTIPLSFIRPE------AINCIER----------RNA 210
                  ||.        ||:.:.....||.:|....|.|      :..|.|.          .||
  Fly    78 KNPNTFGKTLRVLTAVFLLISAFIYAFLFAVPEVTRRGEIREPLVSFGCDETGGFLFQERCGSNA 142

  Fly   211 T-------DFVLTYTR----------------------------TKRDLSAMYEQEHLDMGTGTM 240
            |       :..:..||                            |::.....||.|.....|.::
  Fly   143 TCSRWDQKEGKINLTRCTYSCQNPKLYEPLYVAWLAEVPTVAPSTEQSSEFDYEDEGSTAVTESL 207

  Fly   241 ----------PADEALEEA---EAAHSRHKRSLLLPRIDAGISPVH------------------- 273
                      |||.|..||   |....|..|.:..|.....:.|.|                   
  Fly   208 RTRRDVESSDPADSAGVEAISGEVPLHRSIRQVKKPPTKVYVQPPHVCLTERNQNGEDVVKHCHA 272

  Fly   274 -----------------INFVSNYDD---------------------KYHRDY------------ 288
                             |:...:|||                     .|.:|:            
  Fly   273 YTEDTTSVVMDALMGSAISQEEHYDDYEGWCQYPLEGFQCHIPEEQVNYMKDFKHYMQNDSNCKP 337

  Fly   289 ------VTPIFSSMVY-------RTPDIQKAFFLLLLVILIGEFFSAPAITLADSAVITLLGEDA 340
                  |.|.....|.       .|..:|........:.|||:.|...|:||.::|::..:.|.:
  Fly   338 MIECQVVNPYHEQSVLSDSECTNTTGSVQDTLVGYTTIRLIGDIFPMAALTLLNTAIVIAVRETS 402

  Fly   341 DKYG---HQRMFGSLGW-----GISMFLVGIALDHSTSFSNHPCGAGNKEKNYN------ICFSI 391
            :..|   .|.::|::|:     .:.:|.          |.|.|        |::      |.|.:
  Fly   403 EGRGEVCRQYVWGAIGYVVLFSPLDLFF----------FQNEP--------NHDAALVALIIFIV 449

  Fly   392 FSVLMTCAIISASKITFKYDPIDEQLAAQQQAQFVDPNKRAEEESMNQLAAQLNLPSLAVGSGSA 456
            ..||....::.|:::     |:.                 ..|...:.....|.:|..|:     
  Fly   450 SFVLGAVVLLCATQM-----PLS-----------------PPEWWWHTKTGMLVVPMSAI----- 487

  Fly   457 ASGACAGGVSSFLATGHQPQPHIGAESKVFAQTAKELPEWMTVLTHFKDLKTASFLFVAWFMGFG 521
                                             .:..|| :.|||      ..|.||..::..  
  Fly   488 ---------------------------------RRYTPE-ILVLT------LVSILFGTFWSS-- 510

  Fly   522 IGLIFTFLFWHLQD-----YGGTPTLFGVASVINHVSEIFAYFFSF-RLITQIGHVKVLCLGLIG 580
               |.::|:|...|     |.|             :..|...||:. :.|...||..:...||..
  Fly   511 ---IHSYLWWTFTDVDAVCYSG-------------LILILVLFFNVDKFIEYCGHSNIFIGGLAI 559

  Fly   581 NVLRFLYISYLTNPWMVLPFELMQGITHAAVWAASCSYIAHNTPKHLRASAQGVLQGIHHGLGRG 645
            .|:||..:|.....|:.:..|.::......:|.....|:.|..|:.|.|:.|.:......|||:|
  Fly   560 FVIRFTALSDAQTKWLTVIMETIEPAVIGLIWITIILYMRHAMPRKLTATGQAIAVLAFFGLGKG 624

  Fly   646 CGAIIG------GMFVTYYGTTTTFRWYGI-ACLFVLGFFIFVNFYRKEQGFISEIPVTEDPHQV 703
            .||:||      ...:.::  :.|::|..| ||:..|.:|...|       .|.....|..| |.
  Fly   625 FGALIGLARDERDPKLEFW--SCTYQWLAIVACVVALIYFGIYN-------LILAPRCTAKP-QH 679

  Fly   704 AEETSHLAPHGVPSNPIPRALSNSRLNEMNPNGGPYGTYQTTGGNLDIPG 753
            :||.            |..:.|.:..|..|.||...||....|....:.|
  Fly   680 SEEL------------ISGSASQNFGNTGNGNGAGNGTGNGNGAGASLNG 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
jefNP_001246323.1 MFS 125..187 CDD:304372 16/75 (21%)
MFS 508..>681 CDD:119392 45/185 (24%)
MFS_1 511..>701 CDD:284993 47/202 (23%)
SP1173NP_648053.1 MFS 15..88 CDD:304372 19/72 (26%)
Chromate_transp <552..632 CDD:302665 23/79 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296859918
eggNOG 1 0.900 E1_KOG3762
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR16172
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.