DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jef and CG31663

DIOPT Version :8

Sequence 1:NP_001246323.1 Gene:jef / 36634 FlyBaseID:FBgn0033958 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_001259884.1 Gene:CG31663 / 33363 FlyBaseID:FBgn0051663 Length:966 Species:Drosophila melanogaster

Alignment Length:775 Identity:148/775 - (19%)
Similarity:242/775 - (31%) Gaps:297/775 - (38%)


  Fly   105 FGASTER-----ELIPVKSFYFFFYAAFGSLFPLMGVYFKQMGMNPGQCGILVGMRPFVEFLSAP 164
            ||...:|     .||.:|...|..|.|..||.|.:.::.:.:|:...:..|:....||..|||.|
  Fly    24 FGEFCQRRGINPNLIMLKITLFVMYGATSSLLPYLTIHMQSIGLTVEEIAIIYLALPFTTFLSPP 88

  Fly   165 FWGSYADRCRQGKRLLLGSLACWVLF--------------TIPLSF------------------- 196
            ..|...|:..:.|.:::.||....:|              .:|.:|                   
  Fly    89 ITGFLVDKFGKYKPVVVMSLLLNAIFHHSLLFIPQQEIPGVVPSAFVLRHPDSGDIEVWWSPCPS 153

  Fly   197 --------------------------------------IRPEAINCIERRNATDFVLTYTRTKRD 223
                                                  :||.|.....:|:........|.|...
  Fly   154 RECPEEPELELAVHQCVDYCLMQEQVNPQLYTNTPAYDVRPAATTSTTQRSQLTATTARTTTMEP 218

  Fly   224 LSAMYEQEHLDMGTGTMPADE--ALEEAEAAHSRHKR------------SLLLPRIDAGISP--- 271
            .|...........|.|.||..  || .|....||::.            |.|...::.|:.|   
  Fly   219 SSESSSSPAPTTSTTTSPASSLPAL-FATQTRSRYQEVLNMSSTMFPPMSQLKDALEEGVEPGQS 282

  Fly   272 ----------------------------VHINFVSNYDD------KYHRDYVTPI---------- 292
                                        ||    |:.||      :.|.|...|.          
  Fly   283 SSAELSAMSMQGLNLTNSSQKKLLWSSWVH----SDNDDATYFMLQMHPDLADPTEQLGMEIEQD 343

  Fly   293 ---------------------------------FSSMVYRT------------------------ 300
                                             ...:|.||                        
  Fly   344 ANETVTDILQRFGHDYLVRGNINLTDMDDLDLRCGGLVRRTNMTNIASGAVECMMQRCTFTLNAP 408

  Fly   301 ----PDIQKA----FFLLLLVILIGEFFSAPAITLADSAVITLLGEDADKYGHQRMFGSLGWGIS 357
                ||.::.    |::..|:..:.....:..:|:.|...:|::.:....:|.:|:|.|:|..|.
  Fly   409 EICPPDYKETDEIIFWVYFLLRFLATTMLSAGVTIMDPIALTMIEKYGGDFGRERLFSSIGMAIF 473

  Fly   358 MFLVGIALDHSTSFSNHPCGAGNKEKNYNICFSIFSVLMTCAIISASKITFKYDPIDEQLAAQQQ 422
            ..:.||.:|:|:.      |.|..:  |:..|..:.||:..:.:|...:     |:.|:|.|.  
  Fly   474 SPITGIMIDYSSR------GLGYTD--YSAAFYTYDVLLVISTMSVLMM-----PLGEKLPAD-- 523

  Fly   423 AQFVDPNKRAEEESMNQLAAQLNLPSLAVGSGSAASGACAGGVSSFLATGHQPQPHIGAESKVFA 487
                           |......||..:                           ||:        
  Fly   524 ---------------NVFRDLWNLLKM---------------------------PHV-------- 538

  Fly   488 QTAKELPEWMTVLTHFKDLKTASFLFVAWFMGFGIGLIFTFLFWHLQDYGGTPTLFGVASVINHV 552
                              :....||||   :|...|.|.:|||.:|::.|....|.|:...:..|
  Fly   539 ------------------IAFICFLFV---LGNFWGFIESFLFLYLKELGAPNYLLGITITVGTV 582

  Fly   553 SEIFAYFFSFRLITQI-GHVKVLCLGLIGNVLRFLYISYLTNPWMVLPFELMQGITHAAVWAASC 616
            |.| .:.:....||:| |||.::.:....:..|.:..|::...|...|||.|:.::...:|.|:.
  Fly   583 SSI-PFLYGAEKITRIFGHVNLIIIAFFSHAGRLVGYSFIETAWWCFPFEAMESLSCHLMWVAAA 646

  Fly   617 SYIAHNTPKHLRASAQGVLQGIHHGLGRGCGAIIGGMFVTYYGTTTTFRWYGIACLFVLG 676
            :|.:...||.|.|:..|||...|..||||.|:..||:.:..:||...||:.|:  |.|:|
  Fly   647 TYCSILAPKSLLATLIGVLGMAHFSLGRGSGSFTGGLLIGQFGTRDAFRYMGL--LAVVG 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
jefNP_001246323.1 MFS 125..187 CDD:304372 17/61 (28%)
MFS 508..>681 CDD:119392 56/170 (33%)
MFS_1 511..>701 CDD:284993 56/167 (34%)
CG31663NP_001259884.1 MFS_1_like 36..111 CDD:289593 22/74 (30%)
MFS <423..711 CDD:119392 87/371 (23%)
MFS_1 <423..678 CDD:284993 76/341 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296859812
eggNOG 1 0.900 E1_KOG3762
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR16172
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.