DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Had2 and Had1

DIOPT Version :8

Sequence 1:NP_610974.1 Gene:Had2 / 36624 FlyBaseID:FBgn0033949 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001285320.1 Gene:Had1 / 32592 FlyBaseID:FBgn0286508 Length:315 Species:Drosophila melanogaster

Alignment Length:311 Identity:174/312 (56%)
Similarity:232/312 (74%) Gaps:3/312 (1%)


  Fly     3 SQKIGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASE 67
            ::|:||||||||||:|:||||:.||:|.|||||..|::|||....|:|..||.:..|||.:.|::
  Fly     5 NEKVGIVGSGLIGRSWSMLFASVGYQVVLYDILPEQVSTALTATQKELQDLEAKGLLRGKLTAAQ 69

  Fly    68 QFALIGVTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMPSLYSEGL 132
            |||.|..|..|:||.:.|:.:|||:||.|.|||:||.|||.::...|:::||||||:|||:|..|
  Fly    70 QFACISGTNDLKELVKGAIFVQECIPERLDLKKALYKQLDAVVGPNTILSSSTSTFLPSLFSADL 134

  Fly   133 QKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRIQY 197
            :.:..:||:||:||||::|||||||||||.|..|::||.||..:||:||||.|||:|||.|||||
  Fly   135 KNKANVLVSHPVNPPYYVPLVEIVPAPWTKPEWVKKTRALMEEIGQKPVTLSREIEGFALNRIQY 199

  Fly   198 AILNEVWRLVGSGILSVADVDRVLSQGLGLRYALLGSLETAHLNAPGGVADYFQRFGGEISAVSA 262
            |||||.||||.:|||:|.|:|.|:|.|||.|||.||.||||||||. |:|:||:|:...|.|||.
  Fly   200 AILNETWRLVEAGILNVKDIDSVMSNGLGPRYAFLGPLETAHLNAE-GMANYFERYSNTIYAVSE 263

  Fly   263 TYGETPNTQEDRETLAEIARQCEQLVSLEKLDERRAVRDEFLIQLAKLKKQ 313
            |.|.||  :.:.....|:|:|..::|.|::|.:||..||..|.||:.||.:
  Fly   264 TMGPTP--KMEGPVAVEVAKQLGEMVPLDQLAQRRNYRDNCLTQLSILKNK 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Had2NP_610974.1 PRK06129 5..312 CDD:235706 174/307 (57%)
3HCDH_N 5..184 CDD:280833 102/179 (57%)
3HCDH 189..>256 CDD:279114 46/67 (69%)
Had1NP_001285320.1 PRK06129 7..310 CDD:235706 173/306 (57%)
3HCDH_N 7..183 CDD:280833 99/176 (56%)
3HCDH 191..>265 CDD:279114 51/75 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152038754
eggNOG 1 0.900 E1_COG1250
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I2014
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D462830at33208
OrthoFinder 1 1.000 FOG0005270
orthoMCL 1 0.900 OOG5_131710
Panther 1 1.100 P PTHR43492
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3389
87.920

Return to query results.
Submit another query.