DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Had2 and B0272.3

DIOPT Version :9

Sequence 1:NP_610974.1 Gene:Had2 / 36624 FlyBaseID:FBgn0033949 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_509584.1 Gene:B0272.3 / 181169 WormBaseID:WBGene00007129 Length:309 Species:Caenorhabditis elegans


Alignment Length:228 Identity:55/228 - (24%)
Similarity:108/228 - (47%) Gaps:11/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQFA 70
            :.|:|:||:|...|.:.|.|...|.:.|..:|.|..|.|.:...|.|:.::.....   |:.|.|
 Worm    25 VTIIGAGLMGSGIAQVSANAKLNVTVVDSNQSALEKAQQGIANSLKRVAKKKHADD---AAAQTA 86

  Fly    71 LIG-------VTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMPSLY 128
            |:.       ::|.:.:..::|..:.|.:.|.:.:|:.|:::::...:..|::.::||:...:..
 Worm    87 LVSSVLDRIKMSTNVSDSVKDADLVIEAIVENIDIKRKLFAEVEVAAKPTTLITTNTSSLRLADI 151

  Fly   129 SEGLQKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATN 193
            ...|:.:.:....|..||...:.|:|:|....||.:...:..|...::|:..|..| :..||..|
 Worm   152 GLNLKDKSRFGGLHFFNPVPMMKLLEVVRHTETSDATFNQLVDYGKTVGKTTVACK-DTPGFIVN 215

  Fly   194 RIQYAILNEVWRLVGSGILSVADVDRVLSQGLG 226
            |:....:.|..||...|..|:.|:|..:..|.|
 Worm   216 RLLVPYMFEALRLYERGDASMEDIDVAMKLGAG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Had2NP_610974.1 PRK06129 5..312 CDD:235706 55/228 (24%)
3HCDH_N 5..184 CDD:280833 41/184 (22%)
3HCDH 189..>256 CDD:279114 13/38 (34%)
B0272.3NP_509584.1 FadB 20..308 CDD:224170 55/228 (24%)
3HCDH_N 24..209 CDD:280833 42/187 (22%)
3HCDH 211..308 CDD:279114 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1250
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1.028321 Normalized mean entropy S3790
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.