DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Had2 and Hadh

DIOPT Version :8

Sequence 1:NP_610974.1 Gene:Had2 / 36624 FlyBaseID:FBgn0033949 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_032238.2 Gene:Hadh / 15107 MGIID:96009 Length:314 Species:Mus musculus

Alignment Length:226 Identity:64/227 (28%)
Similarity:108/227 (48%) Gaps:7/227 (3%)


  Fly     6 IGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQF- 69
            :.::|.||:|...|.:.||.|:.|.|.|..|..||.:.:.:::.|.|:.::. ...|.:|.::| 
Mouse    30 VTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLKRMAKKK-FTENPKAGDEFV 93

  Fly    70 ----ALIGVTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMPSLYSE 130
                :.:..:|....:......:.|.:.|.|.||..|:.:||:...|.|:.||:||:...:..:.
Mouse    94 EKTLSCLSTSTDAASVVHSTDLVVEAIVENLKLKNELFQRLDKFAAEHTIFASNTSSLQITNIAN 158

  Fly   131 GLQKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRI 195
            ...::.:....|..||...:.|||::..|.||....|...|...:||:.||:.| :..||..||:
Mouse   159 ATTRQDRFAGLHFFNPVPMMKLVEVIKTPMTSQKTFESLVDFCKTLGKHPVSCK-DTPGFIVNRL 222

  Fly   196 QYAILNEVWRLVGSGILSVADVDRVLSQGLG 226
            ....|.|..||...|..|..|:|..:..|.|
Mouse   223 LVPYLIEAVRLHERGDASKEDIDTAMKLGAG 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Had2NP_610974.1 PRK06129 5..312 CDD:235706 64/227 (28%)
3HCDH_N 5..184 CDD:280833 49/183 (27%)
3HCDH 189..>256 CDD:279114 14/39 (36%)
HadhNP_032238.2 FadB 27..313 CDD:224170 64/227 (28%)
3HCDH_N 29..214 CDD:280833 50/186 (27%)
3HCDH 216..313 CDD:279114 14/39 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1250
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1.028321 Normalized mean entropy S3790
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.