| Sequence 1: | NP_610974.1 | Gene: | Had2 / 36624 | FlyBaseID: | FBgn0033949 | Length: | 315 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_032238.2 | Gene: | Hadh / 15107 | MGIID: | 96009 | Length: | 314 | Species: | Mus musculus | 
| Alignment Length: | 226 | Identity: | 64/226 - (28%) | 
|---|---|---|---|
| Similarity: | 108/226 - (47%) | Gaps: | 7/226 - (3%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     6 IGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQF- 69 
  Fly    70 ----ALIGVTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMPSLYSE 130 
  Fly   131 GLQKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRI 195 
  Fly   196 QYAILNEVWRLVGSGILSVADVDRVLSQGLG 226 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Had2 | NP_610974.1 | PRK06129 | 5..312 | CDD:235706 | 64/226 (28%) | 
| 3HCDH_N | 5..184 | CDD:280833 | 49/182 (27%) | ||
| 3HCDH | 189..>256 | CDD:279114 | 14/38 (37%) | ||
| Hadh | NP_032238.2 | FadB | 27..313 | CDD:224170 | 64/226 (28%) | 
| 3HCDH_N | 29..214 | CDD:280833 | 50/185 (27%) | ||
| 3HCDH | 216..313 | CDD:279114 | 14/38 (37%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1250 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 1.028321 | Normalized mean entropy | S3790 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.760 | |||||