DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12863 and Zcchc4

Sequence 1:NP_610973.3 Gene:CG12863 FlyBaseID:FBgn0033948 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_084461.1 Gene:Zcchc4 MGIID:1926046 Length:512 Species:Mus musculus

Alignment Length:480 Identity:156/481 (32%)
Similarity:228/481 (47%) Gaps:84/481 (17%)


  Fly    20 PEDQHPRCEHGPTVLFNRQSQLPDQ--GYYACSAHRDSKLCNYHLPADQWKGQTTRTA-LTKRD- 80
            |....|.|.||||:||.:.:|..::  .:|||||.||.|.||:.    ||:.:....| |..|: 
Mouse    32 PTAPAPLCPHGPTLLFVKVNQGKEETRKFYACSACRDRKDCNFF----QWEDEKLSEARLAAREI 92

  Fly    81 YPLPCRKPANPAIC------------------------------------------------DPT 97
            :...|:.|.:.|.|                                                .|:
Mouse    93 HNQKCQPPLSRAQCIERYLSFIQLPLAQRKFCQSCQQLLLPADWREHGTHQLSADISVAQLGRPS 157

  Fly    98 LSLTALSQDKVNAQYFFDEAALNFLANQCEHIGASKVICMGAPRLHFHL-------RHKLQSFLL 155
            ..|..|...|.:|||.|.:.:..|||.....:|.|:|:|:||||||..:       |..::|.||
Mouse   158 QLLYPLENKKTHAQYLFADRSCQFLAGLLATLGFSRVLCVGAPRLHEQIRLTASGERSGMRSLLL 222

  Fly   156 DLDERFAEYLGPEEFCLYNMCNNHFFYDRTPFE---QFLAGTSSDRLVIVTDPPFGCRTELISHT 217
            |:|.|::::.....||.|||.|:|||..:...|   :||.......:::|||||||...|.::.|
Mouse   223 DIDFRYSQFYLEGSFCRYNMFNHHFFDGKAALEVCKEFLQEEEGKGVIMVTDPPFGGLVEPLAIT 287

  Fly   218 LRSLRKL--HNQINRLPSTPLSIFWIYPYYSANHIRQEMPELEMCEYRINYTNHLRYTNVGKQSR 280
            .:.|..:  ..|........|.||||:||:..:.|.|..|...|.:|:::|.||..|.: ||..|
Mouse   288 FKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFCMLDYQVDYDNHALYKH-GKTGR 351

  Fly   281 FCGSPVRLFTNVPLRLLQLPPEEGYKYCQKCDCYTAKENLHCNRCGKCPSVNGQTYKHCESCDAC 345
             ..||||:|||||...:.||.||||::|..|..|.::||.||..|..|.|.:|:.:.||..|..|
Mouse   352 -KQSPVRIFTNVPPNKIILPSEEGYRFCSLCQRYVSRENQHCVHCNSCTSKDGRKWSHCFLCKKC 415

  Fly   346 VKPNYVHCSDCRRCTQKEGHNCSFYQTKQHCWMCGQKGHIETKCPN----FRKRKT----NYTKG 402
            |||:::||:.|.||...: |:|  ...|..|::||...|..:.|||    :|..|.    .:.:.
Mouse   416 VKPSWIHCNTCNRCALPD-HSC--LGPKDGCFICGALDHKRSNCPNIGTSWRANKLVEFFGFLEK 477

  Fly   403 CLLCGK---RNHREKRCSYRSKYFR 424
            .||...   ..:|..:.|..|::||
Mouse   478 RLLMSSFLGAIYRSTKLSEDSEFFR 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12863NP_610973.3 N6-adenineMlase 111..>224 CDD:287239 45/123 (37%)
PTZ00368 299..416 CDD:173561 44/128 (34%)
Zcchc4NP_084461.1 zf-GRF 37..81 CDD:284302 21/48 (44%)
N6-adenineMlase 171..327 CDD:287239 55/156 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244812794
eggNOG 1 0.900 E1_KOG4399
Hieranoid 1 1.000
Homologene 1 1.000 H14632
Inparanoid 1 1.050 240 1.000 Inparanoid score I3315
Isobase 1 0.950 0 Normalized mean entropy S5886
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005922
OrthoInspector 1 1.000 T1082293
orthoMCL 1 0.900 OOG5_133444
Panther 1 1.100 LDO PTHR13493
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3585
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.