DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12863 and zcchc4

Sequence 1:NP_610973.3 Gene:CG12863 FlyBaseID:FBgn0033948 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001107071.1 Gene:zcchc4 ZFINID:ZDB-GENE-080204-65 Length:484 Species:Danio rerio

Alignment Length:486 Identity:149/487 (31%)
Similarity:234/487 (48%) Gaps:88/487 (18%)


  Fly     8 KLLLEMEEDDAAPEDQHPRCEHGPTVLFNRQSQLPDQ---GYYACSAHRDSKLCNYHLPADQWKG 69
            :::::.|.|..|     |||.|||.:||.:.....::   .:|||||.||.|.||:...||:...
Zfish    15 EVIVQNESDKTA-----PRCPHGPALLFEKTGHGEEEKGRRFYACSACRDRKDCNFFQWADEKIS 74

  Fly    70 QTTRTA----------------------------LTKRDYPLPCRKPANPA-------------- 92
            :....|                            |.:|.:.:.|:....|.              
Zfish    75 EARMLAREEQNCSKKPLFTHQQYYSRFLEFASLPLEQRRFCVDCQLLILPGEWMNHTKHRALSED 139

  Fly    93 -----ICDPTLSLTALSQDKVNAQYFFDEAALNFLANQCEHIGASKVICMGAPRLHFHLRHK--- 149
                 :..|:|.|..|...|.||||.|.|.:.:||.:....:|..|::|:|.||||..::.:   
Zfish   140 VTVQRLKKPSLLLRPLDNKKSNAQYLFAERSCHFLLDTLSTLGFRKLLCVGTPRLHEMIKIRNLE 204

  Fly   150 -----LQSFLLDLDERFAEYLGPEEFCLYNMCNNHFFYDRTP---FEQFLAGTSSDRLVIVTDPP 206
                 ::|.|||:|.|:.::.|.:|||.|||.|:|||.|...   |:.||.....::||::||||
Zfish   205 DKSPVIRSLLLDIDYRYCQFYGQDEFCRYNMFNHHFFDDEEAVKFFQGFLQEEGGEKLVMITDPP 269

  Fly   207 FGCRTELISHTLRSLRKLHNQINRL--PSTPLSIFWIYPYYSANHIRQEMPELEMCEYRINYTNH 269
            ||...:.::::...:......:|::  .|..:.:.||:||:..:.|.:..|...|.:|:::|.||
Zfish   270 FGGLVKPLANSFSQISMTWKNLNKVSDASAEMPMIWIFPYFFESRILECFPSFSMLDYQVDYDNH 334

  Fly   270 LRYTNVGKQSRFCGSPVRLFTNVPLRLLQLPPEEGYKYCQKCDCYTAKENLHCNRCGKCPSVNGQ 334
            ..|.: ||..| ..||||||||:..:.:.||..|||::|..|:.|.:..|.||.:|..|||.:|:
Zfish   335 PLYKH-GKTGR-KQSPVRLFTNLSPKDIILPEAEGYRFCSVCERYVSAGNKHCPKCDMCPSKDGR 397

  Fly   335 TYKHCESCDACVKPNYVHCSDCRRCTQKEGHNCSFYQTKQHCWMCGQKGHIETKCPNFRKRKTNY 399
            .::||:.|..||||::.|||.|.||...: |.|...||  .|:.||.:.|....||.        
Zfish   398 EWRHCDECGRCVKPSWRHCSSCGRCALPD-HPCGQRQT--GCFNCGSQKHKLRACPK-------- 451

  Fly   400 TKGCLLCGKR------NHREKRCSYRSKYFR 424
             |..|:.|.|      .|:..:...::|..|
Zfish   452 -KRMLVSGDRGAPGLSKHKAGKSRAKNKQKR 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12863NP_610973.3 N6-adenineMlase 111..>224 CDD:287239 43/124 (35%)
PTZ00368 299..416 CDD:173561 44/123 (36%)
zcchc4NP_001107071.1 zf-GRF 27..72 CDD:284302 20/45 (44%)
N6-adenineMlase 163..>270 CDD:287239 41/107 (38%)
DZR 371..420 CDD:289539 22/49 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244816896
eggNOG 1 0.900 E1_KOG4399
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H14632
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D312577at33208
OrthoFinder 1 1.000 FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133444
Panther 1 1.100 LDO PTHR13493
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.