DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12863 and zcchc4

Sequence 1:NP_610973.3 Gene:CG12863 FlyBaseID:FBgn0033948 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001008134.1 Gene:zcchc4 XenbaseID:XB-GENE-1007153 Length:487 Species:Xenopus tropicalis

Alignment Length:472 Identity:154/473 (33%)
Similarity:231/473 (49%) Gaps:96/473 (20%)


  Fly     8 KLLLEMEEDDAAPEDQHPRCEHGPTVLFNRQSQLPDQG--YYACSAHRDSKLCNY---------- 60
            ::||..|..||||:     |.||||:||.:.||..:||  :|||||.||.|.|::          
 Frog    14 QVLLSREVIDAAPQ-----CPHGPTLLFVKVSQGKEQGRRFYACSACRDRKDCHFFQWEDDKVSQ 73

  Fly    61 ------------HLPA---DQWKG---QTTRTALTKRDYPLPCRK---PAN-------PAICDPT 97
                        |.|.   .|:.|   :.|...|.||.:...|::   |.|       ..:.|.:
 Frog    74 ARLAAREEYNKSHQPPMTHAQYVGRFQEFTELPLAKRKFCSDCQQLLLPTNWESHSGHRVLGDIS 138

  Fly    98 LS--------LTALSQDKVNAQYFFDEAALNFLANQCEHIGASKVICMGAPRLHFHLRHK----- 149
            ||        |..|...|.||||.|.|.:..||.:....:|..:|:|:|.||||..::.:     
 Frog   139 LSQLKRPSQLLHPLENKKANAQYLFAERSCTFLMDTIIALGFRRVLCVGTPRLHELIKLRACEGA 203

  Fly   150 ---LQSFLLDLDERFAEYLGPEEFCLYNMCNNHFF---YDRTPFEQFLAGTSSDRLVIVTDPPFG 208
               ::|.|||:|.|::::...||||.|||.|:|||   ..:...::||........::|||||||
 Frog   204 TPPIKSLLLDIDFRYSQFYWEEEFCHYNMFNHHFFGGEAAKMVCQKFLQEEDGKGALLVTDPPFG 268

  Fly   209 CRTELISHTLRSLRKLHNQINRLPSTPLSIFWIYPYYSANHIRQEMPELEMCEYRINYTNHLRYT 273
            ...|.::.:.:.||::....|....:.|.|.|::||:..:.|.|..|:..|.:|:::|.||..|.
 Frog   269 GLVEPLAFSFKRLREMWKTTNPENESNLPILWMFPYFFESRILQCFPDFTMLDYQVDYDNHALYK 333

  Fly   274 NVGKQSRFCGSPVRLFTNVPLRLLQLPPEEGYKYCQKCDCYTAKENLHCNRCGKCPSVNGQTYKH 338
            : ||..| ..||||:||::|...:.||..|||::|..|:.:....|.|||.|..|.|.:|:.:||
 Frog   334 H-GKTGR-KQSPVRIFTDLPPDKIVLPAIEGYRFCSVCERFVCSGNKHCNICNCCTSKDGRPWKH 396

  Fly   339 CESCDACVKPNYVHCSDCRRCTQKEGHNCSFYQTKQHCWMCGQKGHIETKCPNFRKRKTNYTKGC 403
            |..|:.||||::.|||.|..|...:           |  .||..|                 :||
 Frog   397 CTQCNKCVKPSWTHCSACNHCALPD-----------H--PCGTAG-----------------RGC 431

  Fly   404 LLCGKRNHREKRCSYRS 420
            .|||.::|:.:.|.::|
 Frog   432 FLCGGKDHKRRGCPHQS 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12863NP_610973.3 N6-adenineMlase 111..>224 CDD:287239 43/124 (35%)
PTZ00368 299..416 CDD:173561 38/117 (32%)
zcchc4NP_001008134.1 zf-GRF 26..70 CDD:284302 21/49 (43%)
N6-adenineMlase 153..289 CDD:313464 46/136 (34%)
AIR1 <372..>445 CDD:331526 32/103 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244818635
eggNOG 1 0.900 E1_KOG4399
Hieranoid 1 1.000
Homologene 1 1.000 H14632
Inparanoid 1 1.050 241 1.000 Inparanoid score I3125
OMA 1 1.010
OrthoDB 1 1.010 D312577at33208
OrthoFinder 1 1.000 FOG0005922
OrthoInspector 1 1.000 T1058330
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3585
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.