DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12863 and Zcchc4

Sequence 1:NP_610973.3 Gene:CG12863 FlyBaseID:FBgn0033948 Length:437 Species:Drosophila melanogaster
Sequence 2:XP_017454783.1 Gene:Zcchc4 RGDID:1311414 Length:489 Species:Rattus norvegicus

Alignment Length:451 Identity:149/452 (33%)
Similarity:218/452 (48%) Gaps:86/452 (19%)


  Fly    25 PRCEHGPTVLFNRQSQLPDQ--GYYACSAHRDSKLCNYHLPADQWKGQTTRTA------------ 75
            |:|.||||:||.:.||..::  .:|||||.||.|.||:.    ||:.:....|            
  Rat    37 PQCPHGPTLLFVKVSQGKEEPRKFYACSACRDRKDCNFF----QWEDEKLSEARLAAREIHNQRC 97

  Fly    76 --------------------LTKRDYPLPCRKPANPA------------------ICDPTLSLTA 102
                                ||:|.:...|::...||                  |..|:..|..
  Rat    98 QPPLSRAQCIERYLSFIQLPLTQRKFCRSCQQLLLPADWREHGEHQLSADISTTQIARPSQLLYP 162

  Fly   103 LSQDKVNAQYFFDEAALNFLANQCEHIGASKVICMGAPRLHFHLR-------HKLQSFLLDLDER 160
            |...|.:|||.|.:.:..|||.....:|..:|:|:||||||..:|       ..::|.|||:|.|
  Rat   163 LENKKTHAQYLFADRSCQFLAGLLATLGFRRVLCVGAPRLHEQIRLTAPGEKPDMRSLLLDIDFR 227

  Fly   161 FAEYLGPEEFCLYNMCNNHFFYDRTPFE---QFLAGTSSDRLVIVTDPPFGCRTELISHTLRSLR 222
            ::::...|.||.|||.|:|||..:...|   .||.......:::|||||||...|.::.|.:.|.
  Rat   228 YSQFYLEESFCRYNMFNHHFFDGKAALEVCKAFLQEEEGKGVIMVTDPPFGGLVEPLAVTFKKLI 292

  Fly   223 KL--HNQINRLPSTPLSIFWIYPYYSANHIRQEMPELEMCEYRINYTNHLRYTNVGKQSRFCGSP 285
            .:  ..|........|.||||:||:..:.|.|..|...|.:|:::|.||..|.: ||..| ..||
  Rat   293 AMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFCMLDYQVDYDNHALYKH-GKTGR-KQSP 355

  Fly   286 VRLFTNVPLRLLQLPPEEGYKYCQKCDCYTAKENLHCNRCGKCPSVNGQTYKHCESCDACVKPNY 350
            ||:|||:|...:.||.||||::|..|..|.::||.||..|..|.|.:|:.:.||..|..||||::
  Rat   356 VRIFTNIPPNKIILPSEEGYRFCSVCQRYVSRENQHCVHCNSCTSKDGRKWSHCFFCKKCVKPSW 420

  Fly   351 VHCSDCRRCTQKEGHNCSFYQTKQHCWMCGQKGHIETKCPNF-------------RKRKTN 398
            :||:.|.||...: |:|  ...|..|::||...|..:.||:.             ::||:|
  Rat   421 IHCNTCNRCALPD-HSC--LGPKDGCFICGSLDHKRSNCPSIGASQRANNAVRKQKQRKSN 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12863NP_610973.3 N6-adenineMlase 111..>224 CDD:287239 45/123 (37%)
PTZ00368 299..416 CDD:173561 41/114 (36%)
Zcchc4XP_017454783.1 zf-GRF 37..81 CDD:284302 22/48 (46%)
N6-adenineMlase 171..327 CDD:287239 55/156 (35%)
zf-DHHC 407..>436 CDD:303066 13/30 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244815321
eggNOG 1 0.900 E1_KOG4399
Hieranoid 1 1.000
Homologene 1 1.000 H14632
Inparanoid 1 1.050 243 1.000 Inparanoid score I3169
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312577at33208
OrthoFinder 1 1.000 FOG0005922
OrthoInspector 1 1.000 T1085895
orthoMCL 1 0.900 OOG5_133444
Panther 1 1.100 LDO PTHR13493
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.