DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12863 and ZCCHC4

Sequence 1:NP_610973.3 Gene:CG12863 FlyBaseID:FBgn0033948 Length:437 Species:Drosophila melanogaster
Sequence 2:XP_011512137.1 Gene:ZCCHC4 HGNCID:22917 Length:528 Species:Homo sapiens

Alignment Length:510 Identity:161/511 (32%)
Similarity:234/511 (46%) Gaps:119/511 (23%)


  Fly    16 DDAAPEDQHPRCEHGPTVLFNRQSQLPDQ--GYYACSAHRDSKLCNYHLPADQWKGQ-------- 70
            |.|.|.   |.|.||||:||.:.:|..::  .:|||||.||.|.||:.    ||:.:        
Human    32 DPAVPA---PLCPHGPTLLFVKVTQGKEETRRFYACSACRDRKDCNFF----QWEDEKLSGARLA 89

  Fly    71 ------------TTRTALTKR-----DYPLPCRK----------P------------ANPAICD- 95
                        .:||...:|     :.||..||          |            .|.:|.. 
Human    90 AREAHNRRCQPPLSRTQCVERYLKFIELPLTQRKFCQTCQQLLLPDDWGQHSEHQVLGNVSITQL 154

  Fly    96 --PTLSLTALSQDKVNAQYFFDEAALNFLANQCEHIGASKVICMGAPRLHFHL--------RHKL 150
              |:..|..|...|.||||.|.:.:..||.:....:|..:|:|:|.||||..:        :..:
Human   155 RRPSQLLYPLENKKTNAQYLFADRSCQFLVDLLSALGFRRVLCVGTPRLHELIKLTASGDKKSNI 219

  Fly   151 QSFLLDLDERFAEYLGPEEFCLYNMCNNHFFYDRTPFE---QFLAGTSSDRLVIVTDPPFGCRTE 212
            :|.|||:|.|::::...:.||.|||.|:|||..:|..|   .||.....:.:::|||||||...|
Human   220 KSLLLDIDFRYSQFYMEDSFCHYNMFNHHFFDGKTALEVCRAFLQEDKGEGIIMVTDPPFGGLVE 284

  Fly   213 LISHTLRSLRKL--HNQINRLPSTPLSIFWIYPYYSANHIRQEMPELEMCEY------------- 262
            .::.|.:.|..:  ..|........|.||||:||:..:.|.|..|..:|.:|             
Human   285 PLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFQMLDYQAIPFFLDYRLFL 349

  Fly   263 --RINYTNHLRYTNVGKQSRFCGSPVRLFTNVPLRLLQLPPEEGYKYCQKCDCYTAKENLHCNRC 325
              :::|.||..|.: ||..| ..||||:|||:|...:.||.||||::|..|..|.:.||.||..|
Human   350 PFKVDYDNHALYKH-GKTGR-KQSPVRIFTNIPPNKIILPTEEGYRFCSPCQRYVSLENQHCELC 412

  Fly   326 GKCPSVNGQTYKHCESCDACVKPNYVHCSDCRRCTQKEGHNCSFYQTKQHCWMCGQKGHIETKCP 390
            ..|.|.:|:.:.||..|..||||:::|||.|..|...: |:|.  ..|..|::||:..|..:.||
Human   413 NSCTSKDGRKWNHCFLCKKCVKPSWIHCSICNHCAVPD-HSCE--GPKHGCFICGELDHKRSTCP 474

  Fly   391 NF-------------RKRKTN-----YTKGCLLCGKRNH-----REKRCSYRSKY 422
            |.             ::||:|     .|||    ...||     |:||.....:|
Human   475 NIATSKRANKAVRKQKQRKSNKMKMETTKG----QSMNHTSATRRKKRRERAHQY 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12863NP_610973.3 N6-adenineMlase 111..>224 CDD:287239 42/124 (34%)
PTZ00368 299..416 CDD:173561 50/140 (36%)
ZCCHC4XP_011512137.1 zf-GRF 38..82 CDD:284302 21/48 (44%)
N6-adenineMlase 172..329 CDD:287239 52/157 (33%)
zf-DHHC 424..>453 CDD:303066 13/30 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244813401
eggNOG 1 0.900 E1_KOG4399
Hieranoid 1 1.000
Homologene 1 1.000 H14632
Inparanoid 1 1.050 240 1.000 Inparanoid score I3284
Isobase 1 0.950 0 Normalized mean entropy S5886
OMA 1 1.010
OrthoDB 1 1.010 D312577at33208
OrthoFinder 1 1.000 FOG0005922
OrthoInspector 1 1.000 T1072235
orthoMCL 1 0.900 OOG5_133444
Panther 1 1.100 LDO PTHR13493
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.720

Return to query results.
Submit another query.