DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12863 and F33A8.4

Sequence 1:NP_610973.3 Gene:CG12863 FlyBaseID:FBgn0033948 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_496368.1 Gene:F33A8.4 WormBaseID:WBGene00009352 Length:467 Species:Caenorhabditis elegans

Alignment Length:409 Identity:112/410 (27%)
Similarity:191/410 (47%) Gaps:95/410 (23%)


  Fly    20 PED---QHPRCEHGPTVLFNRQSQLP--DQGYYACSAHRD-SKLCNYHLPADQWKGQ-------- 70
            |.|   |.|:|.|||.:||.:::. |  ::.::||:.:|: ::.|::.|..::..|:        
 Worm    73 PTDDLPQVPQCSHGPCLLFEKKNG-PEVEETFFACAIYRNQAEFCDFKLTFNKETGEIEVKEAVE 136

  Fly    71 ---------------------TTRTALTKRDYPLPCRKPAN------PAICD---------PTLS 99
                                 ...|.::..|..|.|:...|      ..:|:         ||..
 Worm   137 GEEDAEKKKKKKKIFGYNRIPKALTEMSPTDTVLYCKTCINVFPNKHECVCEPVEREALERPTHL 201

  Fly   100 LTALSQDKVNAQYFFDEAALNFLANQCEHIGASKVICMGAPRLHFHLR--HKLQS-FLLDLDERF 161
            |..:::....:|:||....|:.:....|......::|:||||:..::|  |..:: ||||.|:||
 Worm   202 LPPVNEQHGESQFFFSTETLDVITKAVEKSKVDGILCIGAPRIFENIRALHPEKNVFLLDYDKRF 266

  Fly   162 AEYLGPEEFCLYNMCNNHF-----------FYDRTPFEQFLAGTSSDRLVIVTDPPFGCRTELIS 215
            |::...:::..|:|..:||           |:|:           |..::::||||||...|.:.
 Worm   267 AKFFPSKQYAQYSMLVDHFFDKIAEPKLMEFFDK-----------SKSILMITDPPFGVFMEPLL 320

  Fly   216 HTLRSLRKLHNQINRLPST--PLSIFW---IYPYYSANHIRQEMPELEMCEYRINYTNHLRYTNV 275
            .::..::|      |..||  ..::|:   :.|.|...::..  ....|.:||:.|..|..|.:.
 Worm   321 KSIEKMKK------RFVSTGKEETLFYSMIVLPIYIRKYVLH--GNFWMSDYRVTYEGHKLYQHS 377

  Fly   276 GKQSRFCGSPVRLFTNVPLRLLQLPPEEGYKYCQKCDCYTAKENLHCNRCGKCPSVNGQTYKHCE 340
            .|      :.|||||::|:..:.|....|||:|:.||.|..:.|:||:||..|.||....:.|||
 Worm   378 EK------TIVRLFTDLPVECIDLKNVAGYKFCEVCDRYVTERNVHCDRCQACTSVEQGKWNHCE 436

  Fly   341 SCDACVKPNYVHCSDCRRC 359
            .||.||||.||||:.|.||
 Worm   437 KCDKCVKPRYVHCAQCARC 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12863NP_610973.3 N6-adenineMlase 111..>224 CDD:287239 35/127 (28%)
PTZ00368 299..416 CDD:173561 32/62 (52%)
F33A8.4NP_496368.1 N6-adenineMlase 210..361 CDD:287239 41/170 (24%)
DUF3795 404..452 CDD:289445 25/48 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244811909
eggNOG 1 0.900 E1_KOG4399
Hieranoid 1 1.000
Homologene 1 1.000 H14632
Inparanoid 1 1.050 170 1.000 Inparanoid score I2722
Isobase 1 0.950 0 Normalized mean entropy S5886
OMA 1 1.010
OrthoDB 1 1.010 D312577at33208
OrthoFinder 1 1.000 FOG0005922
OrthoInspector 1 1.000 T475826
orthoMCL 1 0.900 OOG5_133444
Panther 1 1.100 LDO PTHR13493
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3585
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.