DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Su(var)2-HP2 and CHS5

Sequence 1:NP_610972.2 Gene:Su(var)2-HP2 FlyBaseID:FBgn0026427 Length:3257 Species:Drosophila melanogaster
Sequence 2:NP_013434.1 Gene:CHS5 SGDID:S000004322 Length:671 Species:Saccharomyces cerevisiae

Alignment Length:696 Identity:148/697 (21%)
Similarity:254/697 (36%) Gaps:182/697 (26%)


  Fly   356 EQSAASDKEANKKERD-LEPPEASSSAKSSASK-ASGSRKLYDVANNATLEAVERMSLDLAE--- 415
            :...:.:.|..||:|: .:..:|....|....| .|...|:.:|...:.:.|.:.:.|..|:   
Yeast    46 KMQVSQNLEEEKKQRNHFKSIQAKILEKYGTHKPESPVLKIVNVTQTSCVLAWDPLKLGSAKLKS 110

  Fly   416 ----------------------QIMEIDVERSYEFEKRSASKSRSLSRSKIPADSSTSQLGHVRK 458
                                  :|..:.|:..|||:.:..:.|.:|...|:..  .|.::..:..
Yeast   111 LILYRKGIRSMVIPNPFKVTTTKISGLSVDTPYEFQLKLITTSGTLWSEKVIL--RTHKMTDMSG 173

  Fly   459 LTYSSERLDQPEPLGTQLRRSKSESLPKRG-RPRGQKQRKNRGATMEEKSANCRDGEGEPVKRKR 522
            :|.....||   ||........|:.|...| ||      ..|...::.....|.|.:.|....:.
Yeast   174 ITVCLGPLD---PLKEISDLQISQCLSHIGARP------LQRHVAIDTTHFVCNDLDNEESNEEL 229

  Fly   523 GRPR----KIIPKEEAKTAETENTI-----------ESLNTNV---PLS---IDTSKEN------ 560
            .|.:    .|:..|..:..|.|..|           :|:..|.   |::   :..||||      
Yeast   230 IRAKHNNIPIVRPEWVRACEVEKRIVGVRGFYLDADQSILKNYTFPPVNEEELSYSKENEPVAEV 294

  Fly   561 ------PETETVNLEVPIKQDELVSDLDNAK---ELTGSTNLPQDDIE-----MASNHQETDLKC 611
                  || :|.::|.....::..|:...||   |.:|....|...:|     ..:...||.::.
Yeast   295 ADENKMPE-DTTDVEQVASPNDNESNPSEAKEQGEKSGHETAPVSPVEDPLHASTALENETTIET 358

  Fly   612 APDRVALDKSE--STPKVEEEQLCKVDTPSDTALDE--SKVSESAKNHIELEDKDKDKEETQKES 672
            ....|...|||  .||.:||.   |.|:.::..::|  ..|:||:.|......|.:|.:.     
Yeast   359 VNPSVRSLKSEPVGTPNIEEN---KADSSAEAVVEEPNEAVAESSPNEEATGQKSEDTDT----- 415

  Fly   673 PNGNSKETNENSVIVTNEVELPAKKAEAKAEAGNIVEESDSQLAEDFKLAEEILAAEVGKGVE-A 736
               :|.|..:|..:.|.||   |:.......||...|.:|....|..:...||...||.:.:| |
Yeast   416 ---HSNEQADNGFVQTEEV---AENNITTESAGENNEPADDAAMEFGRPEAEIETPEVNESIEDA 474

  Fly   737 NEVSVTSVQGEQNPVIEIVKELEQETISEVVPAQNDQSSVED--QTLADKENPVEKPS-PVK--- 795
            ||                             ||::....|||  :.:.|...|||..: ||:   
Yeast   475 NE-----------------------------PAEDSNEPVEDSNKPVKDSNKPVEDSNKPVEDSN 510

  Fly   796 APSSSKDEPPAEENLPAPD-QDPIEQQKTPV------------AKNQQHDKEHNEAPKAESLSVS 847
            .|....::|..:.|.|..| .:|:|....||            .::|:.|.|....||..:.||:
Yeast   511 KPVEDSNKPVEDANEPVEDTSEPVEDAGEPVQETNEFTTDIASPRHQEEDIELEAEPKDATESVA 575

  Fly   848 DIPSS-SVTPSKKRNH-------------SSPANTPKKSKEIEALQSSVPRRALRSDKATPQNLR 898
            ..||: .|.|.:|.:.             |..:.|.:|::...:|:||    |:..::.|     
Yeast   576 VEPSNEDVKPEEKGSEAEDDINNVSKEAASGESTTHQKTEASASLESS----AVTEEQET----- 631

  Fly   899 ESRSKRTLKTELTLLMDDTMRRSSPRLGRSPAESHSSHERSPMEKK 944
                     ||..:..||.:  |:....::...|:|:.:::...||
Yeast   632 ---------TEAEVNTDDVL--STKEAKKNTGNSNSNKKKNKKNKK 666

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Su(var)2-HP2NP_610972.2 MDN1 <596..845 CDD:227596 65/278 (23%)
PTZ00449 <739..1091 CDD:185628 49/240 (20%)
PTZ00108 <1132..1374 CDD:240271
PTZ00121 <1720..>2291 CDD:173412
CHS5NP_013434.1 Chs5_N 4..76 CDD:260117 6/30 (20%)
fn3_2 77..165 CDD:293498 15/90 (17%)
BRCT 168..248 CDD:214602 17/89 (19%)
DBP 338..649 CDD:289157 85/374 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.